hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/smart.HMMs.bin Sequence file: /db/iprscan/tmp/20080806/iprscan-20080806-18111875/chunk_1/iprscan-20080806-18111875.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: af25953 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- SM00264 103.8 1.9e-26 1 SM00456 53.7 2.3e-11 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- SM00456 1/1 93 126 .. 1 34 [] 53.7 2.3e-11 SM00264 1/1 493 570 .. 1 91 [] 103.8 1.9e-26 Alignments of top-scoring domains: SM00456: domain 1 of 1, from 93 to 126: score 53.7, E = 2.3e-11 *->plPpgWeerkdpdsGrpYYyNheTketqWekPre<-* plPpgWe +dp++G p++++h++++t+W +Pr af25953 93 PLPPGWEIKIDPQTGWPFFVDHNSRTTTWNDPRV 126 SM00264: domain 1 of 1, from 493 to 570: score 103.8, E = 1.9e-26 *->siakinevlgeVlKlerkieqevqssdfdgkkddkeylmlsElLmkl ++k++++l++V +++eq+v++ f+gkk+dk+ylm++E+L+k+ af25953 493 GVLKVEAILEKV----QGLEQAVDN--FEGKKTDKKYLMIEEYLTKE 533 LlkLDsmlvdvegraEslaediReaRKrlvreiqklLkklDslk<-* Ll+LDs vd+egra d+R+aR+ vr++q++L+kl++++ af25953 534 LLALDS--VDPEGRA-----DVRQARRDGVRKVQTILEKLEQKA 570 //