hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/Pfam.bin Sequence file: /db/iprscan/tmp/20080806/iprscan-20080806-19282810/chunk_1/iprscan-20080806-19282810.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: ah00631 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- PF00993.11.ls Class II histocompatibility antigen, alp 153.8 4.2e-43 1 PF00993.11.fs Class II histocompatibility antigen, alp 151.8 1.7e-42 1 PF07654.6.fs Immunoglobulin C1-set domain 67.1 7.9e-20 1 PF07654.6.ls Immunoglobulin C1-set domain 46.4 9e-11 1 PF00047.15.fs Immunoglobulin domain 22.9 1.6e-05 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- PF00993.11.fs 1/1 45 125 .. 1 84 [] 151.8 1.7e-42 PF00993.11.ls 1/1 45 125 .. 1 84 [] 153.8 4.2e-43 PF07654.6.fs 1/1 134 186 .. 1 56 [. 67.1 7.9e-20 PF07654.6.ls 1/1 134 205 .. 1 92 [] 46.4 9e-11 PF00047.15.fs 1/1 141 188 .. 1 49 [. 22.9 1.6e-05 Alignments of top-scoring domains: PF00993.11.fs: domain 1 of 1, from 45 to 125: score 151.8, E = 1.7e-42 *->dHvgiyGinfyQssgpsGeythefDGDElFYvDLekKetVwrLPeFa +Hv i+ ++fy + sGe++++fDGDE+F+vD+ kKetVwrL eF+ ah00631 45 EHVIIQ-AEFYLNPDQSGEFMFDFDGDEIFHVDMAKKETVWRLEEFG 90 dfasfdgfpQgalaniaicKhNLdvlikrsNsTPatn<-* +fasf+ +Qgalania+ K+NL++++krsN TP tn ah00631 91 RFASFE--AQGALANIAVDKANLEIMTKRSNYTPITN 125 PF00993.11.ls: domain 1 of 1, from 45 to 125: score 153.8, E = 4.2e-43 *->dHvgiyGinfyQssgpsGeythefDGDElFYvDLekKetVwrLPeFa +Hv i+ ++fy + sGe++++fDGDE+F+vD+ kKetVwrL eF+ ah00631 45 EHVIIQ-AEFYLNPDQSGEFMFDFDGDEIFHVDMAKKETVWRLEEFG 90 dfasfdgfpQgalaniaicKhNLdvlikrsNsTPatn<-* +fasf+ +Qgalania+ K+NL++++krsN TP tn ah00631 91 RFASFE--AQGALANIAVDKANLEIMTKRSNYTPITN 125 PF07654.6.fs: domain 1 of 1, from 134 to 186: score 67.1, E = 7.9e-20 *->ppgspepelgkpntLvClVtgFyPpdItVtWlkNGqevtegvestep + sp+ el++pn+L+C+++ F Pp+++VtWl+NG++vt+gv++t + ah00631 134 TN-SPV-ELREPNVLICFIDKFTPPVVNVTWLRNGKPVTTGVSETVF 178 lpkngDgtY<-* lp + D+ + ah00631 179 LP-REDHLF 186 PF07654.6.ls: domain 1 of 1, from 134 to 205: score 46.4, E = 9e-11 *->ppgspepelgkpntLvClVtgFyPpdItVtWlkNGqevtegvestep + sp+ el++pn+L+C+++ F Pp+++VtWl+NG++vt+gv++t + ah00631 134 TN-SPV-ELREPNVLICFIDKFTPPVVNVTWLRNGKPVTTGVSETVF 178 lpkngDgtYqlsSyLtftasepesgdtYtCrVeHesLkvenePlt<-* lp + D+ + + + f + p + +Pl+ ah00631 179 LP-REDHLFLTPHLIHFYLTSP--------------IP---SPLV 205 PF00047.15.fs: domain 1 of 1, from 141 to 188: score 22.9, E = 1.6e-05 *->GesvtLtCsvsgfgppdvtvtWlrngk.lt.gvlvtssenngdstyq e++ L C f pp v+vtWlrngk++t+gv+ t++ ++ d+ + ah00631 141 REPNVLICFIDKFTPPVVNVTWLRNGKpVTtGVSETVFLPREDHLF- 186 tsLt<-* Lt ah00631 187 --LT 188 //