hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/Pfam.bin Sequence file: /db/iprscan/tmp/20080806/iprscan-20080806-20274360/chunk_1/iprscan-20080806-20274360.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: ah01627 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- PF00046.19.ls Homeobox domain 224.4 2.4e-64 3 PF00046.19.fs Homeobox domain 218.4 1.5e-62 3 PF00096.16.ls Zinc finger, C2H2 type 96.1 1e-25 7 PF00096.16.fs Zinc finger, C2H2 type 81.9 1.8e-21 7 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- PF00096.16.ls 1/7 175 199 .. 1 24 [] 19.0 0.015 PF00096.16.ls 2/7 232 256 .. 1 24 [] 26.2 0.00011 PF00096.16.fs 2/7 232 256 .. 1 24 [] 24.3 8.5e-05 PF00046.19.ls 1/3 580 636 .. 1 57 [] 70.9 3.7e-18 PF00046.19.fs 1/3 580 636 .. 1 57 [] 68.9 1.5e-17 PF00096.16.ls 5/7 753 775 .. 1 24 [] 24.3 0.0004 PF00046.19.fs 2/3 842 898 .. 1 57 [] 73.1 8.4e-19 PF00046.19.ls 2/3 842 898 .. 1 57 [] 75.1 2.1e-19 PF00046.19.ls 3/3 1050 1106 .. 1 57 [] 78.4 2.1e-20 PF00046.19.fs 3/3 1050 1106 .. 1 57 [] 76.4 8.3e-20 Alignments of top-scoring domains: PF00096.16.ls: domain 1 of 7, from 175 to 199: score 19.0, E = 0.015 *->ykCpfdCgksFsrksnLkrHlrt..H<-* ykC+ +C++sF++k L H ++ +H ah01627 175 YKCT-VCKESFTQKNILLVHYNSvsH 199 PF00096.16.ls: domain 2 of 7, from 232 to 256: score 26.2, E = 0.00011 *->ykCpfdCgksFsrksnLkrHlrt..H<-* +kC+ +C s++++s+L+ H+r+ H ah01627 232 FKCT-VCRVSYNQSSTLEIHMRSvlH 256 PF00096.16.fs: domain 2 of 7, from 232 to 256: score 24.3, E = 8.5e-05 *->ykCpfdCgksFsrksnLkrHlrt..H<-* +kC+ +C s++++s+L+ H+r+ H ah01627 232 FKCT-VCRVSYNQSSTLEIHMRSvlH 256 PF00046.19.ls: domain 1 of 3, from 580 to 636: score 70.9, E = 3.7e-18 *->rrkRTtftpeQleeLEkeFqknrYPsreeReeLAkkLgLterqVkvW r +RT ft Q+++L+ +F+ + YP e e+LA LgL r+V vW ah01627 580 RFSRTKFTEFQTQALQSFFETSAYPKDGEVERLASLLGLASRVVVVW 626 FQNRRaKwKk<-* FQN R+K +k ah01627 627 FQNARQKARK 636 PF00046.19.fs: domain 1 of 3, from 580 to 636: score 68.9, E = 1.5e-17 *->rrkRTtftpeQleeLEkeFqknrYPsreeReeLAkkLgLterqVkvW r +RT ft Q+++L+ +F+ + YP e e+LA LgL r+V vW ah01627 580 RFSRTKFTEFQTQALQSFFETSAYPKDGEVERLASLLGLASRVVVVW 626 FQNRRaKwKk<-* FQN R+K +k ah01627 627 FQNARQKARK 636 PF00096.16.ls: domain 5 of 7, from 753 to 775: score 24.3, E = 0.0004 *->ykCpfdCgksFsrksnLkrHlrtH<-* ++C+ +C sFs+++ L++H+r H ah01627 753 HTCD-QCAISFSSQDLLTSHRRLH 775 PF00046.19.fs: domain 2 of 3, from 842 to 898: score 73.1, E = 8.4e-19 *->rrkRTtftpeQleeLEkeFqknrYPsreeReeLAkkLgLterqVkvW +r RTt+ peQle+L + ++++++P+r++ ++++ gL +r+V+vW ah01627 842 KRLRTTILPEQLEILYRWYMQDSNPTRKMLDCISEEVGLKKRVVQVW 888 FQNRRaKwKk<-* FQN Ra+++k ah01627 889 FQNTRARERK 898 PF00046.19.ls: domain 2 of 3, from 842 to 898: score 75.1, E = 2.1e-19 *->rrkRTtftpeQleeLEkeFqknrYPsreeReeLAkkLgLterqVkvW +r RTt+ peQle+L + ++++++P+r++ ++++ gL +r+V+vW ah01627 842 KRLRTTILPEQLEILYRWYMQDSNPTRKMLDCISEEVGLKKRVVQVW 888 FQNRRaKwKk<-* FQN Ra+++k ah01627 889 FQNTRARERK 898 PF00046.19.ls: domain 3 of 3, from 1050 to 1106: score 78.4, E = 2.1e-20 *->rrkRTtftpeQleeLEkeFqknrYPsreeReeLAkkLgLterqVkvW rr RT ++ Ql++++++++ r+P+ +e e L +++gL++r+++vW ah01627 1050 RRYRTQMSSLQLKIMKACYEAYRTPTMQECEVLGEEIGLPKRVIQVW 1096 FQNRRaKwKk<-* FQN RaK+Kk ah01627 1097 FQNARAKEKK 1106 PF00046.19.fs: domain 3 of 3, from 1050 to 1106: score 76.4, E = 8.3e-20 *->rrkRTtftpeQleeLEkeFqknrYPsreeReeLAkkLgLterqVkvW rr RT ++ Ql++++++++ r+P+ +e e L +++gL++r+++vW ah01627 1050 RRYRTQMSSLQLKIMKACYEAYRTPTMQECEVLGEEIGLPKRVIQVW 1096 FQNRRaKwKk<-* FQN RaK+Kk ah01627 1097 FQNARAKEKK 1106 //