hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/Pfam.bin Sequence file: /db/iprscan/tmp/20090617/iprscan-20090617-19273885/chunk_1/iprscan-20090617-19273885.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: ah01915 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- PF00046.19.ls Homeobox domain 90.4 5.2e-24 1 PF00046.19.fs Homeobox domain 88.4 2.1e-23 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- PF00046.19.fs 1/1 127 183 .. 1 57 [] 88.4 2.1e-23 PF00046.19.ls 1/1 127 183 .. 1 57 [] 90.4 5.2e-24 Alignments of top-scoring domains: PF00046.19.fs: domain 1 of 1, from 127 to 183: score 88.4, E = 2.1e-23 *->rrkRTtftpeQleeLEkeFqknrYPsreeReeLAkkLgLterqVkvW r +RT ft Q+eeLE +F+ ++YP++++R+eLA+ Lg te+ V+vW ah01915 127 RTRRTKFTLLQVEELESVFRHTQYPDVPTRRELAENLGVTEDKVRVW 173 FQNRRaKwKk<-* F N+Ra++++ ah01915 174 FKNKRARCRR 183 PF00046.19.ls: domain 1 of 1, from 127 to 183: score 90.4, E = 5.2e-24 *->rrkRTtftpeQleeLEkeFqknrYPsreeReeLAkkLgLterqVkvW r +RT ft Q+eeLE +F+ ++YP++++R+eLA+ Lg te+ V+vW ah01915 127 RTRRTKFTLLQVEELESVFRHTQYPDVPTRRELAENLGVTEDKVRVW 173 FQNRRaKwKk<-* F N+Ra++++ ah01915 174 FKNKRARCRR 183 //