hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/smart.HMMs.bin Sequence file: /db/iprscan/tmp/20090617/iprscan-20090617-19273885/chunk_1/iprscan-20090617-19273885.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: ah01915 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- SM00389 91.6 9.5e-23 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- SM00389 1/1 126 188 .. 1 63 [] 91.6 9.5e-23 Alignments of top-scoring domains: SM00389: domain 1 of 1, from 126 to 188: score 91.6, E = 9.5e-23 *->krrkRtsftpeQleeLEkeFeknpYPsreereeLAkeLgLterqVkv +r +Rt ft Q+eeLE +F +++YP++++r+eLA+ Lg te V+v ah01915 126 PRTRRTKFTLLQVEELESVFRHTQYPDVPTRRELAENLGVTEDKVRV 172 WFQNRRakwkrqekkk<-* WF+N+Ra+++r++++ ah01915 173 WFKNKRARCRRHQREL 188 //