hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/smart.HMMs.bin Sequence file: /db/iprscan/tmp/20080806/iprscan-20080806-21070069/chunk_1/iprscan-20080806-21070069.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: ah02859 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- SM00382 116.0 4.1e-30 2 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- SM00382 1/2 580 753 .. 1 92 [] 56.5 3.4e-12 SM00382 2/2 1212 1397 .. 1 92 [] 59.5 4.3e-13 Alignments of top-scoring domains: SM00382: domain 1 of 2, from 580 to 753: score 56.5, E = 3.4e-12 *->pgevvllvGppGsGKTTlaralarllgp..gviyidge......... g+ v+++G GsGKT l+ a+++++ +g i+i+g+ ++ ah02859 580 EGKLVGICGSVGSGKTSLISAILGQMTLleGSIAISGTfayvaqqaw 626 .................................................. + +++ +++ ++++ ++ ++ + + +++ + ++++ ah02859 627 ilnatlrdnilfgkeydeerynsvlnscclrpdlailpssdlteigerga 676 ...ggqrirlalalark...dvlllDEitslld................. + +ggqr+r+ la+a ++++++++lD++ s+ld + +++ ++ +++++ ah02859 677 nlsGGQRQRISLARALYsdrSIYILDDPLSALDahvgnhifnsairkhlk 726 .vtviattndldpallrrrfdrrivllril<-* ++tv+++t+ l+ ++ d++i+++ + ah02859 727 sKTVLFVTHQLQYLVDC---DEVIFMKEGC 753 SM00382: domain 2 of 2, from 1212 to 1397: score 59.5, E = 4.3e-13 *->pgevvllvGppGsGKTTlaralarllgp..gviyidge......... p+e++++vG++GsGK+ l +al rl + ++g+i idg + ++ + + ah02859 1212 PKEKIGIVGRTGSGKSSLGMALFRLVELsgGCIKIDGVrisdiglad 1258 .................................................. +++ + ++ ++ +++ + ++ +++ + ++ + ++ + ah02859 1259 lrsklsiipqepvlfsgtvrsnldpfnqytedqiwdalerthmkeciaql 1308 .................ggqrir.lalalark.dvlllDEitslld.... + +++ +++++ + g++++ +a+al+r ++l+lDE+t++ d + + ah02859 1309 plklesevmengdnfsvGERQLLcIARALLRHcKILILDEATAAMDtetd 1358 .............vtviattndldpallrrrfdrrivllril<-* ++ ++ ++ ++t + +++ ++ +++ +dr++vl ++ ah02859 1359 lliqetireafadCTMLTIAH---RLHTVLGSDRIMVLAQGQ 1397 //