hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/smart.HMMs.bin Sequence file: /db/iprscan/tmp/20080806/iprscan-20080806-22415986/chunk_1/iprscan-20080806-22415986.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: ah04488 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- SM00233 79.8 3.4e-19 1 SM00456 54.9 1e-11 2 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- SM00456 1/2 15 47 .. 1 34 [] 22.2 0.071 SM00456 2/2 60 92 .. 1 34 [] 32.7 5.1e-05 SM00233 1/1 170 289 .. 1 82 [] 79.8 3.4e-19 Alignments of top-scoring domains: SM00456: domain 1 of 2, from 15 to 47: score 22.2, E = 0.071 *->plPpgWeerkdpdsGrpYYyNheTketqWekPre<-* +lP+ W +d Gr++++N + + t+W +Pr ah04488 15 TLPEHWSYGVCRD-GRVFFINDQLRCTTWLHPRT 47 SM00456: domain 2 of 2, from 60 to 92: score 32.7, E = 5.1e-05 *->plPpgWeerkdpdsGrpYYyNheTketqWekPre<-* +lP gWee ++++ G Y+++h+ ++t + +P+ ah04488 60 DLPRGWEEGFTEE-GASYFIDHNQQTTAFRHPVT 92 SM00233: domain 1 of 1, from 170 to 289: score 79.8, E = 3.4e-19 *->vikeGwLlkks...k.swkkryfvLfngvLlyyksk...kpkgsipL v+ +GwL+k+ +++ + wk+r+fvL + +L+yyk++++++ gsipL ah04488 170 VVVRGWLHKQDssgMrLWKRRWFVLADYCLFYYKDSreeAVLGSIPL 216 sgcsvre.p.........cFeivt.dr....................tll ++ +++ +++++ +++ +F+ v+++ + ++++ +++ ++++ +t++ ah04488 217 PSYVISPvApedrisrkySFKAVHtGMraliynsstagsqaeqsgmrTYY 266 lqAeseeereeWvealqsaiaka<-* ++A+++e+++ Wv+a+++a++ + ah04488 267 FSADTQEDMNAWVRAMNQAAQVL 289 //