hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/Pfam.bin Sequence file: /db/iprscan/tmp/20080806/iprscan-20080806-23061187/chunk_1/iprscan-20080806-23061187.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: ah04724 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- PF08516.2.fs ADAM cysteine-rich 96.8 1.3e-26 1 PF08516.2.ls ADAM cysteine-rich 61.1 3.4e-15 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- PF08516.2.ls 1/1 16 112 .. 1 118 [] 61.1 3.4e-15 PF08516.2.fs 1/1 19 112 .. 30 118 .] 96.8 1.3e-26 Alignments of top-scoring domains: PF08516.2.ls: domain 1 of 1, from 16 to 112: score 61.1, E = 3.4e-15 *->DGtPCqnnqgYCYnGnCptrdqQCqelFGpgAkvApdsCYeelNskG + + +g+ +Ap++C++ +Ns G ah04724 16 -----HAS---------------------SGSHPAPEACFQVVNSAG 36 drfGNCGkesrngtyipCepqDvkCGkLqCtnvs.lpllgeh...atviy d +GNCG++s g ++pC+ +D++CGkLqC+++++ +l +++ + +++++ ah04724 37 DAHGNCGQDS-EGHFLPCAGRDALCGKLQCQGGKpSLLAPHMvpvDSTVH 85 tningvtCwgtdyhlgm..ddpDiGlV<-* ++ ++vtC+g+ + ++ + d +GlV ah04724 86 LDGQEVTCRGALALPSAqlDLLGLGLV 112 PF08516.2.fs: domain 1 of 1, from 19 to 112: score 96.8, E = 1.3e-26 *->pgAkvApdsCYeelNskGdrfGNCGkesrngtyipCepqDvkCGkLq +g+ +Ap++C++ +Ns Gd +GNCG++s g ++pC+ +D++CGkLq ah04724 19 SGSHPAPEACFQVVNSAGDAHGNCGQDS-EGHFLPCAGRDALCGKLQ 64 Ctnvs.lpllgeh...atviytningvtCwgtdyhlgm..ddpDiGlV<- C+++++ +l +++ + +++++++ ++vtC+g+ + ++ + d +GlV ah04724 65 CQGGKpSLLAPHMvpvDSTVHLDGQEVTCRGALALPSAqlDLLGLGLV 112 * ah04724 - - //