hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/smart.HMMs.bin Sequence file: /db/iprscan/tmp/20080806/iprscan-20080806-23241469/chunk_1/iprscan-20080806-23241469.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: ah04962 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- SM00027 151.7 7.6e-41 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- SM00027 1/1 182 277 .. 1 98 [] 151.7 7.6e-41 Alignments of top-scoring domains: SM00027: domain 1 of 1, from 182 to 277: score 151.7, E = 7.6e-41 *->eWaispedkakYdqiFrsldpdqdGtvsGaqakpiflkSgLPqtlLa +W i+ e++++Y ++Frsl+pd + ++sG++ak++f kS+L+ ++L+ ah04962 182 PWRITEEQREYYVNQFRSLQPDPSSFISGSVAKNFFTKSKLSIPELS 228 kIWaLaDidkdGeLdrePEFalAmhLiyrklnGgepiPasLPpelippsk +IW+L+D d+dG L+++ EF++A+hLi +nG +p+P LPp l+p+++ ah04962 229 YIWELSDADCDGALTLP-EFCAAFHLIVARKNG-YPLPEGLPPTLQPEYL 276 r<-* + ah04962 277 Q 277 //