hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/Pfam.bin Sequence file: /db/iprscan/tmp/20080807/iprscan-20080807-01331943/chunk_1/iprscan-20080807-01331943.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: aj00591 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- PF07716.5.ls Basic region leucine zipper 76.3 8.8e-20 1 PF07716.5.fs Basic region leucine zipper 74.4 2.9e-19 1 PF00170.11.fs bZIP transcription factor 26.5 7.5e-07 1 PF00170.11.ls bZIP transcription factor 28.5 2.3e-05 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- PF00170.11.fs 1/1 220 284 .. 1 65 [] 26.5 7.5e-07 PF00170.11.ls 1/1 220 284 .. 1 65 [] 28.5 2.3e-05 PF07716.5.fs 1/1 221 274 .. 1 57 [] 74.4 2.9e-19 PF07716.5.ls 1/1 221 274 .. 1 57 [] 76.3 8.8e-20 Alignments of top-scoring domains: PF00170.11.fs: domain 1 of 1, from 220 to 284: score 26.5, E = 7.5e-07 *->ekelKrerRkqkNReAArrsRlRKqaeieeLeekveeLeaeNkaLrk +k+ K R+ kN +AA+rsR ++ + + + +++ Le+eN+aLr aj00591 220 QKDEKYWTRRKKNNVAAKRSRDARRLKENQITIRAAFLEKENTALRT 266 elerLkkevakLksenee<-* e+ +L+kev k k +++ aj00591 267 EVAELRKEVGKCKTIVSK 284 PF00170.11.ls: domain 1 of 1, from 220 to 284: score 28.5, E = 2.3e-05 *->ekelKrerRkqkNReAArrsRlRKqaeieeLeekveeLeaeNkaLrk +k+ K R+ kN +AA+rsR ++ + + + +++ Le+eN+aLr aj00591 220 QKDEKYWTRRKKNNVAAKRSRDARRLKENQITIRAAFLEKENTALRT 266 elerLkkevakLksenee<-* e+ +L+kev k k +++ aj00591 267 EVAELRKEVGKCKTIVSK 284 PF07716.5.fs: domain 1 of 1, from 221 to 274: score 74.4, E = 2.9e-19 *->kddeyrdrRrlrNneAAkrsReKkKqreeeleervkeLeeeNaqLLk kd++y+ rR+ +Nn+AAkrsR++++++e+++ +r+ +Le+eN +L aj00591 221 KDEKYWTRRK-KNNVAAKRSRDARRLKENQITIRAAFLEKENTAL-- 264 rqkveqLekE<-* r +v+ L+kE aj00591 265 RTEVAELRKE 274 PF07716.5.ls: domain 1 of 1, from 221 to 274: score 76.3, E = 8.8e-20 *->kddeyrdrRrlrNneAAkrsReKkKqreeeleervkeLeeeNaqLLk kd++y+ rR+ +Nn+AAkrsR++++++e+++ +r+ +Le+eN +L aj00591 221 KDEKYWTRRK-KNNVAAKRSRDARRLKENQITIRAAFLEKENTAL-- 264 rqkveqLekE<-* r +v+ L+kE aj00591 265 RTEVAELRKE 274 //