hmmpfam - search one or more sequences against HMM database
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file:                 /db/iprscan/data/smart.HMMs.bin
Sequence file:            /db/iprscan/tmp/20080807/iprscan-20080807-01331943/chunk_1/iprscan-20080807-01331943.nocrc
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query sequence: aj00591
Accession:      [none]
Description:    [none]

Scores for sequence family classification (score includes all domains):
Model    Description                                    Score    E-value  N 
-------- -----------                                    -----    ------- ---
SM00338                                                  63.8    2.1e-14   1

Parsed for domains:
Model    Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
-------- ------- ----- -----    ----- -----      -----  -------
SM00338    1/1     220   284 ..     1    65 []    63.8  2.1e-14

Alignments of top-scoring domains:
SM00338: domain 1 of 1, from 220 to 284: score 63.8, E = 2.1e-14
                   *->ekdeKrrrRrerNReAArrsReRKkayieeLedkveeLeaENesLrk
                      +kdeK++ Rr +N++AA+rsR+ ++ +  +   +++ Le+EN++Lr+
     aj00591   220    QKDEKYWTRRKKNNVAAKRSRDARRLKENQITIRAAFLEKENTALRT 266  

                   eleqLrreleklkselee<-*
                   e+++Lr+e+ k k+++++   
     aj00591   267 EVAELRKEVGKCKTIVSK    284  

//