hmmpfam - search one or more sequences against HMM database
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file:                 /db/iprscan/data/Pfam.bin
Sequence file:            /db/iprscan/tmp/20080807/iprscan-20080807-03073154/chunk_1/iprscan-20080807-03073154.nocrc
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query sequence: bf00778
Accession:      [none]
Description:    [none]

Scores for sequence family classification (score includes all domains):
Model    Description                                    Score    E-value  N 
-------- -----------                                    -----    ------- ---
PF00400.22.ls WD domain, G-beta repeat                        66.8    6.4e-17   4
PF00400.22.fs WD domain, G-beta repeat                        61.6    2.2e-16   5

Parsed for domains:
Model    Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
-------- ------- ----- -----    ----- -----      -----  -------
PF00400.22.fs   3/5     308   347 ..     1    38 []    34.9  7.2e-09
PF00400.22.ls   2/4     308   347 ..     1    38 []    36.9  6.4e-08
PF00400.22.fs   4/5     362   392 ..     7    38 .]    16.1   0.0015

Alignments of top-scoring domains:
PF00400.22.fs: domain 3 of 5, from 308 to 347: score 34.9, E = 7.2e-09
                   *->geck.vl.gHtstVtcvafspdsgpllasgSrDgtikiWd<-*
                       +c++++ gH ++++ ++f+p +++ll+s S D+ +++W+   
     bf00778   308    MQCIkHYvGHGNAINELKFHPRDPNLLLSVSKDHALRLWN    347  

PF00400.22.ls: domain 2 of 4, from 308 to 347: score 36.9, E = 6.4e-08
                   *->geck.vl.gHtstVtcvafspdsgpllasgSrDgtikiWd<-*
                       +c++++ gH ++++ ++f+p +++ll+s S D+ +++W+   
     bf00778   308    MQCIkHYvGHGNAINELKFHPRDPNLLLSVSKDHALRLWN    347  

PF00400.22.fs: domain 4 of 5, from 362 to 392: score 16.1, E = 0.0015
                   *->gHtstVtcvafspdsgpllasgSrDgtikiWd<-*
                      gH + V + +++   g+ + s++ D+++k+W    
     bf00778   362    GHRDEVLSADYDLL-GEKIMSCGMDHSLKLWR    392  

//