hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/Pfam.bin Sequence file: /db/iprscan/tmp/20080807/iprscan-20080807-03222286/chunk_1/iprscan-20080807-03222286.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: bf04924 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- PF00681.10.fs Plectin repeat 494.6 1.1e-145 10 PF00681.10.ls Plectin repeat 478.0 1e-140 8 PF00435.11.fs Spectrin repeat 28.6 5.4e-08 4 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- PF00681.10.fs 1/10 1494 1538 .. 1 45 [] 72.8 1.2e-20 PF00681.10.ls 1/8 1494 1538 .. 1 45 [] 74.7 2.6e-19 PF00681.10.ls 2/8 1570 1614 .. 1 45 [] 54.2 4e-13 PF00681.10.fs 3/10 1570 1614 .. 1 45 [] 52.2 1.4e-14 PF00681.10.ls 3/8 1699 1743 .. 1 45 [] 35.0 2.5e-07 PF00681.10.fs 5/10 1737 1781 .. 1 45 [] 76.5 9.3e-22 PF00681.10.ls 4/8 1744 1781 .. 1 45 [] 48.1 2.7e-11 PF00681.10.ls 5/8 1813 1857 .. 1 45 [] 76.3 9e-20 PF00681.10.fs 6/10 1813 1857 .. 1 45 [] 74.3 4.1e-21 PF00681.10.fs 7/10 1906 1948 .. 1 45 [] 43.5 5.3e-12 PF00681.10.ls 6/8 1906 1948 .. 1 45 [] 45.4 1.8e-10 PF00681.10.ls 7/8 2096 2140 .. 1 45 [] 77.6 3.6e-20 PF00681.10.fs 9/10 2096 2140 .. 1 45 [] 75.6 1.7e-21 PF00681.10.ls 8/8 2172 2216 .. 1 45 [] 66.7 7e-17 PF00681.10.fs 10/10 2172 2216 .. 1 45 [] 64.7 2.8e-18 Alignments of top-scoring domains: PF00681.10.fs: domain 1 of 10, from 1494 to 1538: score 72.8, E = 1.2e-20 *->lrlLEAQlaTGGliDPvtgerLsveeAvrrGLvdpetaqkLleae<- ++lLEAQ+aTGG+iDP+++e+L+v++A++r+L+d + +q++ +ae bf04924 1494 VMLLEAQAATGGIIDPHRNEKLTVDSAIARDLIDFDDRQQIYAAE 1538 * bf04924 - - PF00681.10.ls: domain 1 of 8, from 1494 to 1538: score 74.7, E = 2.6e-19 *->lrlLEAQlaTGGliDPvtgerLsveeAvrrGLvdpetaqkLleae<- ++lLEAQ+aTGG+iDP+++e+L+v++A++r+L+d + +q++ +ae bf04924 1494 VMLLEAQAATGGIIDPHRNEKLTVDSAIARDLIDFDDRQQIYAAE 1538 * bf04924 - - PF00681.10.ls: domain 2 of 8, from 1570 to 1614: score 54.2, E = 4e-13 *->lrlLEAQlaTGGliDPvtgerLsveeAvrrGLvdpetaqkLleae<- +rlLEAQ+a+GG++DPv ++ L+ ++A++rGL+d+++++ L +++ bf04924 1570 MRLLEAQIASGGVVDPVNSVFLPKDVALARGLIDRDLYRSLNDPR 1614 * bf04924 - - PF00681.10.fs: domain 3 of 10, from 1570 to 1614: score 52.2, E = 1.4e-14 *->lrlLEAQlaTGGliDPvtgerLsveeAvrrGLvdpetaqkLleae<- +rlLEAQ+a+GG++DPv ++ L+ ++A++rGL+d+++++ L +++ bf04924 1570 MRLLEAQIASGGVVDPVNSVFLPKDVALARGLIDRDLYRSLNDPR 1614 * bf04924 - - PF00681.10.ls: domain 3 of 8, from 1699 to 1743: score 35.0, E = 2.5e-07 *->lrlLEAQlaTGGliDPvtgerLsveeAvrrGLvdpetaqkLleae<- +L++ +++G+ t ++L ++eA++ GLv+p+ta Llea+ bf04924 1699 KDFLQGSSCIAGIYNETTKQKLGIYEAMKIGLVRPGTALELLEAQ 1743 * bf04924 - - PF00681.10.fs: domain 5 of 10, from 1737 to 1781: score 76.5, E = 9.3e-22 *->lrlLEAQlaTGGliDPvtgerLsveeAvrrGLvdpetaqkLleae<- l lLEAQ+aTG+++DPv++ rL+veeA++rGLv+ e+ +kLl+ae bf04924 1737 LELLEAQAATGFIVDPVSNLRLPVEEAYKRGLVGIEFKEKLLSAE 1781 * bf04924 - - PF00681.10.ls: domain 4 of 8, from 1744 to 1781: score 48.1, E = 2.7e-11 *->lrlLEAQlaTGGliDPvtgerLsveeAvrrGLvdpetaqkLleae<- +aTG+++DPv++ rL+veeA++rGLv+ e+ +kLl+ae bf04924 1744 -------AATGFIVDPVSNLRLPVEEAYKRGLVGIEFKEKLLSAE 1781 * bf04924 - - PF00681.10.ls: domain 5 of 8, from 1813 to 1857: score 76.3, E = 9e-20 *->lrlLEAQlaTGGliDPvtgerLsveeAvrrGLvdpetaqkLleae<- +rlLEAQ+aTGG+iDP+ ++rL+v+ A++rG+ ++e+ ++L++++ bf04924 1813 IRLLEAQIATGGIIDPKESHRLPVDIAYKRGYFNEELSEILSDPS 1857 * bf04924 - - PF00681.10.fs: domain 6 of 10, from 1813 to 1857: score 74.3, E = 4.1e-21 *->lrlLEAQlaTGGliDPvtgerLsveeAvrrGLvdpetaqkLleae<- +rlLEAQ+aTGG+iDP+ ++rL+v+ A++rG+ ++e+ ++L++++ bf04924 1813 IRLLEAQIATGGIIDPKESHRLPVDIAYKRGYFNEELSEILSDPS 1857 * bf04924 - - PF00681.10.fs: domain 7 of 10, from 1906 to 1948: score 43.5, E = 5.3e-12 *->lrlLEAQlaTGGliDPvtgerLsveeAvrrGLvdpetaqkLleae<- + L +++ ++DP+t++ +sv+eA+++GL+d et+ L+e+e bf04924 1906 KNTLRKRRVV--IVDPETNKEMSVQEAYKKGLIDYETFKELCEQE 1948 * bf04924 - - PF00681.10.ls: domain 6 of 8, from 1906 to 1948: score 45.4, E = 1.8e-10 *->lrlLEAQlaTGGliDPvtgerLsveeAvrrGLvdpetaqkLleae<- + L +++ ++DP+t++ +sv+eA+++GL+d et+ L+e+e bf04924 1906 KNTLRKRRVV--IVDPETNKEMSVQEAYKKGLIDYETFKELCEQE 1948 * bf04924 - - PF00681.10.ls: domain 7 of 8, from 2096 to 2140: score 77.6, E = 3.6e-20 *->lrlLEAQlaTGGliDPvtgerLsveeAvrrGLvdpetaqkLleae<- +rlLEAQ++TGG+i+P tg++Ls+++Av +G +d+++a++L+ a+ bf04924 2096 QRLLEAQACTGGIIHPTTGQKLSLQDAVSQGVIDQDMATRLKPAQ 2140 * bf04924 - - PF00681.10.fs: domain 9 of 10, from 2096 to 2140: score 75.6, E = 1.7e-21 *->lrlLEAQlaTGGliDPvtgerLsveeAvrrGLvdpetaqkLleae<- +rlLEAQ++TGG+i+P tg++Ls+++Av +G +d+++a++L+ a+ bf04924 2096 QRLLEAQACTGGIIHPTTGQKLSLQDAVSQGVIDQDMATRLKPAQ 2140 * bf04924 - - PF00681.10.ls: domain 8 of 8, from 2172 to 2216: score 66.7, E = 7e-17 *->lrlLEAQlaTGGliDPvtgerLsveeAvrrGLvdpetaqkLleae<- +r+LE+Q++TGGl+DP+ ++r+s eeA+r+G +d + aq+L++ + bf04924 2172 QRFLEFQYLTGGLVDPEVHGRISTEEAIRKGFIDGRAAQRLQDTS 2216 * bf04924 - - PF00681.10.fs: domain 10 of 10, from 2172 to 2216: score 64.7, E = 2.8e-18 *->lrlLEAQlaTGGliDPvtgerLsveeAvrrGLvdpetaqkLleae<- +r+LE+Q++TGGl+DP+ ++r+s eeA+r+G +d + aq+L++ + bf04924 2172 QRFLEFQYLTGGLVDPEVHGRISTEEAIRKGFIDGRAAQRLQDTS 2216 * bf04924 - - //