hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/smart.HMMs.bin Sequence file: /db/iprscan/tmp/20080807/iprscan-20080807-03222286/chunk_1/iprscan-20080807-03222286.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: bf04924 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- SM00250 620.1 7.7e-182 18 SM00150 30.6 0.00021 3 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- SM00150 1/3 228 317 .. 1 104 [] 1.9 5.9 SM00150 2/3 320 420 .. 1 104 [] 21.2 0.11 SM00150 3/3 936 1065 .. 1 104 [] 7.6 1.8 SM00250 1/18 1457 1493 .. 1 39 [] 20.9 0.18 SM00250 2/18 1494 1531 .. 1 39 [] 48.3 1e-09 SM00250 3/18 1532 1569 .. 1 39 [] 48.1 1.1e-09 SM00250 4/18 1570 1607 .. 1 39 [] 40.1 3e-07 SM00250 5/18 1611 1645 .. 1 39 [] 16.0 3.5 SM00250 6/18 1646 1681 .. 1 39 [] 5.6 1e+02 SM00250 7/18 1699 1736 .. 1 39 [] 43.9 2.1e-08 SM00250 8/18 1737 1774 .. 1 39 [] 47.3 2e-09 SM00250 9/18 1775 1812 .. 1 39 [] 40.7 2e-07 SM00250 10/18 1813 1850 .. 1 39 [] 38.7 7.8e-07 SM00250 11/18 1854 1888 .. 1 39 [] 17.1 2.5 SM00250 12/18 1904 1941 .. 1 39 [] 43.2 3.4e-08 SM00250 13/18 1955 1992 .. 1 39 [] 29.0 0.00063 SM00250 14/18 2058 2095 .. 1 39 [] 37.9 1.3e-06 SM00250 15/18 2096 2133 .. 1 39 [] 60.4 2.3e-13 SM00250 16/18 2134 2171 .. 1 39 [] 1.7 3.5e+02 SM00250 17/18 2172 2209 .. 1 39 [] 50.5 2.2e-10 SM00250 18/18 2210 2247 .. 1 39 [] 30.6 0.00021 Alignments of top-scoring domains: SM00150: domain 1 of 3, from 228 to 317: score 1.9, E = 5.9 *->qqFlrdadel.eaWleekeqllssedlgeskDlesveallkkHqale +F + + + + W++ + + + +g Dl+sve+ + H + bf04924 228 DEFTKHVTSEcLGWMRQQRAEMDMVAWG--VDLASVEQHINSHRGIH 272 aelaaheervdalnelgeqLieesghpdaeeIeerleelnerWeeLlela + + ++ ++d++++ L e+ +I + l+e++e+Ll+++ bf04924 273 NSIGDYRWQLDKIKAD---LREK------SAIYQ----LEEEYENLLKAS 309 eeRrqkLe<-* eR +L bf04924 310 FERMDHLR 317 SM00150: domain 2 of 3, from 320 to 420: score 21.2, E = 0.11 *->qqFlrdadeleaWleeke.qllssedlgeskDlesveallkkHqale q ++ ++ W+++ e++ l + + +++ ++++ + + bf04924 320 QNIIQATSREIMWINDCEeEELLYDWS---DKNTNIAQKQEAFSIRM 363 aelaaheervdalnelgeqLieesghpdaeeIeerleelnerWeeLlela l+ +e ++++l+++ +qL+ + +hp++++Ie+ ++ l+++W +l+ + bf04924 364 SQLEVKEKELNKLKQESDQLVLN-QHPASDKIEAYMDTLQTQWSWILQIT 412 eeRrqkLe<-* + +L+ bf04924 413 KCIDVHLK 420 SM00150: domain 3 of 3, from 936 to 1065: score 7.6, E = 1.8 *->qqFlrdadeleaWleeke...qllssedlgeskDlesveallkkHqa + + ++ + + +Wl ++++++ l+s+ + +D +v++ l +++ bf04924 936 RNYRDNYQAFCKWLYDAKrrqDSLESMKF---GDSNTVMRFLNEQKN 979 leaelaaheervdalnelgeqLieesghpdaeeIeerl............ l e++ ++++ +++++ +e ++ + ++ ++ ++ + + + bf04924 980 LHSEISGKRDKSEEVQKIAELCANS-IKDYELQLASYTsgletllnipik 1028 ...............eelnerWeeLlelaeeRrqkLe<-* ++ +++++ ++ +++++r+ eLl ++ + + L bf04924 1029 rtmiqspsgvilqeaADVHARYIELLTRSGDYYRFLS 1065 SM00250: domain 1 of 18, from 1457 to 1493: score 20.9, E = 0.18 *->qrlleaqaqatgGiiDPetgeklSveeAirrGlidpetg<-* q +l+++ +++G +ek+S+ eA r+ li+pe+ bf04924 1457 QPFLRGAG-SIAGASAS-PKEKYSLVEAKRKKLISPEST 1493 SM00250: domain 2 of 18, from 1494 to 1531: score 48.3, E = 1e-09 *->qrlleaqaqatgGiiDPetgeklSveeAirrGlidpetg<-* lleaqa atgGiiDP+++ekl+v+ Ai+r lid +++ bf04924 1494 VMLLEAQA-ATGGIIDPHRNEKLTVDSAIARDLIDFDDR 1531 SM00250: domain 3 of 18, from 1532 to 1569: score 48.1, E = 1.1e-09 *->qrlleaqaqatgGiiDPetgeklSveeAirrGlidpetg<-* q++ a++ a++G+ DP +g+++Sv eAi+++lid+etg bf04924 1532 QQIYAAEK-AITGFDDPFSGKTVSVSEAIKKNLIDRETG 1569 SM00250: domain 4 of 18, from 1570 to 1607: score 40.1, E = 3e-07 *->qrlleaqaqatgGiiDPetgeklSveeAirrGlidpetg<-* rlleaq+ a+gG++DP+ + l+ + A++rGlid++ + bf04924 1570 MRLLEAQI-ASGGVVDPVNSVFLPKDVALARGLIDRDLY 1607 SM00250: domain 5 of 18, from 1611 to 1645: score 16.0, E = 3.5 *->qrlleaqaqatgGiiDPetgeklSveeAirrGlidpetg<-* + + q+ ++DP+t++k+S+ + +r+ i+p tg bf04924 1611 NDPRDSQK----NFVDPVTKKKVSYVQLKERCRIEPHTG 1645 SM00250: domain 6 of 18, from 1646 to 1681: score 5.6, E = 1e+02 *->qrlleaqaq..atgGiiDPetgeklSveeAirrGlidpetg<-* ++ll +q+ + + Gi+ P ++v e + G++ p t+ bf04924 1646 LLLLSVQKRsmSFQGIRQP-----VTVTELVDSGILRPSTV 1681 SM00250: domain 7 of 18, from 1699 to 1736: score 43.9, E = 2.1e-08 *->qrlleaqaqatgGiiDPetgeklSveeAirrGlidpetg<-* +++l++++ +++Gi+ ++t++kl ++eA++ Gl+ p+t+ bf04924 1699 KDFLQGSS-CIAGIYNETTKQKLGIYEAMKIGLVRPGTA 1736 SM00250: domain 8 of 18, from 1737 to 1774: score 47.3, E = 2e-09 *->qrlleaqaqatgGiiDPetgeklSveeAirrGlidpetg<-* + lleaqa atg+i+DP+++ +l+veeA++rGl+ e+ bf04924 1737 LELLEAQA-ATGFIVDPVSNLRLPVEEAYKRGLVGIEFK 1774 SM00250: domain 9 of 18, from 1775 to 1812: score 40.7, E = 2e-07 *->qrlleaqaqatgGiiDPetgeklSveeAirrGlidpetg<-* +ll a++ a++G+ DPetg +S+++A++++li+++ g bf04924 1775 EKLLSAER-AVTGYNDPETGNIISLFQAMNKELIEKGHG 1812 SM00250: domain 10 of 18, from 1813 to 1850: score 38.7, E = 7.8e-07 *->qrlleaqaqatgGiiDPetgeklSveeAirrGlidpetg<-* +rlleaq+ atgGiiDP+ +++l+v+ A++rG e bf04924 1813 IRLLEAQI-ATGGIIDPKESHRLPVDIAYKRGYFNEELS 1850 SM00250: domain 11 of 18, from 1854 to 1888: score 17.1, E = 2.5 *->qrlleaqaqatgGiiDPetgeklSveeAirrGlidpetg<-* + ++++ G++DP t e l++++ +r++ d etg bf04924 1854 SDPSDDTK----GFFDPNTEENLTYLQLKERCIKDEETG 1888 SM00250: domain 12 of 18, from 1904 to 1941: score 43.2, E = 3.4e-08 *->qrlleaqaqatgGiiDPetgeklSveeAirrGlidpetg<-* + ++ + +++i+DPet++++Sv+eA+++Glid et+ bf04924 1904 SQKNTLRK-RRVVIVDPETNKEMSVQEAYKKGLIDYETF 1941 SM00250: domain 13 of 18, from 1955 to 1992: score 29.0, E = 0.00063 *->qrlleaqaqatgGiiDPetgeklSveeAirrGlidpetg<-* + + + + ++++++D++tg ++ +++Ai +Gl+d+ ++ bf04924 1955 TITGSDGS-TRVVLVDRKTGSQYDIQDAIDKGLVDRKFF 1992 SM00250: domain 14 of 18, from 2058 to 2095: score 37.9, E = 1.3e-06 *->qrlleaqaqatgGiiDPetgeklSveeAirrGlidpetg<-* ++le+++ +++ i+D+e ek+S+ e i+rG++d +tg bf04924 2058 SDTLEESS-PIAAIFDTENLEKISITEGIERGIVDSITG 2095 SM00250: domain 15 of 18, from 2096 to 2133: score 60.4, E = 2.3e-13 *->qrlleaqaqatgGiiDPetgeklSveeAirrGlidpetg<-* qrlleaqa +tgGii+P+tg+klS+++A+ +G+id +++ bf04924 2096 QRLLEAQA-CTGGIIHPTTGQKLSLQDAVSQGVIDQDMA 2133 SM00250: domain 16 of 18, from 2134 to 2171: score 1.7, E = 3.5e+02 *->qrlleaqaqatgGiiDPetgeklSveeAirrGlidpetg<-* +rl aq+ a +G+ + ++k+S eA++ ++ e g bf04924 2134 TRLKPAQK-AFIGFEGVKGKKKMSAAEAVKEKWLPYEAG 2171 SM00250: domain 17 of 18, from 2172 to 2209: score 50.5, E = 2.2e-10 *->qrlleaqaqatgGiiDPetgeklSveeAirrGlidpetg<-* qr+le+q +tgG++DPe + ++S eeAir+G+id + + bf04924 2172 QRFLEFQY-LTGGLVDPEVHGRISTEEAIRKGFIDGRAA 2209 SM00250: domain 18 of 18, from 2210 to 2247: score 30.6, E = 0.00021 *->qrlleaqaqatgGiiDPetgeklSveeAirrGlidpetg<-* qrl + ++ + + + +P+t+ k+S+++Ai+r +++ +tg bf04924 2210 QRLQDTSS-YAKILTCPKTKLKISYKDAINRSMVEDITG 2247 //