hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/Pfam.bin Sequence file: /db/iprscan/tmp/20080807/iprscan-20080807-04580388/chunk_1/iprscan-20080807-04580388.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: bh00252 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- PF00412.12.fs LIM domain 71.7 4.2e-20 2 PF00412.12.ls LIM domain 66.7 6.9e-17 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- PF00412.12.fs 1/2 9 66 .. 1 61 [] 64.7 4.2e-18 PF00412.12.ls 1/1 9 66 .. 1 61 [] 66.7 6.9e-17 Alignments of top-scoring domains: PF00412.12.fs: domain 1 of 2, from 9 to 66: score 64.7, E = 4.2e-18 *->CagCgkpIydrelvrrAldkvwHpeCFrCavCgkpLgegdeffekdg C+ C+k++y +e v + ++++H +CF C+vC+k+L++++ + ++ + bh00252 9 CGVCQKTVYFAEEV-QCEGNSFHKSCFLCMVCKKNLDSTT-VAVHGE 53 sklYCkhDyyklfg<-* ++YCk++y k++g bh00252 54 -EIYCKSCYGKKYG 66 PF00412.12.ls: domain 1 of 1, from 9 to 66: score 66.7, E = 6.9e-17 *->CagCgkpIydrelvrrAldkvwHpeCFrCavCgkpLgegdeffekdg C+ C+k++y +e v + ++++H +CF C+vC+k+L++++ + ++ + bh00252 9 CGVCQKTVYFAEEV-QCEGNSFHKSCFLCMVCKKNLDSTT-VAVHGE 53 sklYCkhDyyklfg<-* ++YCk++y k++g bh00252 54 -EIYCKSCYGKKYG 66 //