hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/smart.HMMs.bin Sequence file: /db/iprscan/tmp/20080807/iprscan-20080807-07255886/chunk_1/iprscan-20080807-07255886.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: bm00752 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- SM00348 197.0 1.7e-54 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- SM00348 1/1 39 150 .. 1 118 [] 197.0 1.7e-54 Alignments of top-scoring domains: SM00348: domain 1 of 1, from 39 to 150: score 197.0, E = 1.7e-54 *->maerrmrLrpWLveqveSgqYPGHLcWlDeEKTrFRIPWkHaarsdf m+++++r+ pWLv+q+++gq +G + W+++ +TrFRIPWkH r+d bm00752 39 MGTPKPRILPWLVSQLDLGQLEG-VAWVNKSRTRFRIPWKHGLRQDA 84 deeeDaeiFkawavarGiyqpggrspdpkeckkWkarlrcAlrksrdfee + +eD+ iF+awa+a+G y pg+++pd ++Wk+++r Al++ +++++ bm00752 85 Q-QEDFGIFQAWAEATGAYVPGRDKPDL---PTWKRNFRSALNRKEGLRL 130 ikdrsrddppdpykVyrLlpe<-* +drs+ dp+dp+k+y+++++ bm00752 131 AEDRSK-DPHDPHKIYEFVNS 150 //