hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/Pfam.bin Sequence file: /db/iprscan/tmp/20080807/iprscan-20080807-07315401/chunk_1/iprscan-20080807-07315401.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: bm00771 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- PF00412.12.ls LIM domain 142.0 1.5e-39 2 PF00412.12.fs LIM domain 138.0 2.7e-39 2 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- PF00412.12.fs 1/2 40 99 .. 1 61 [] 53.8 6e-15 PF00412.12.ls 1/2 40 99 .. 1 61 [] 55.8 1.3e-13 PF00412.12.fs 2/2 104 163 .. 1 61 [] 84.2 9.9e-24 PF00412.12.ls 2/2 104 163 .. 1 61 [] 86.2 9.4e-23 Alignments of top-scoring domains: PF00412.12.fs: domain 1 of 2, from 40 to 99: score 53.8, E = 6e-15 *->CagCgkpIydrelvrrAldkvwHpeCFrCavCgkpLgegde.ffekd C+gC++ I dr+ + +A d +wH++C+ C Cg+ Lge +++ + k bm00771 40 CGGCQQNIGDRYFL-KAIDQYWHEDCLSCDLCGCRLGEVGRrLYYKL 85 gsklYCkhDyyklfg<-* g + +C++Dy++lfg bm00771 86 G-RKLCRRDYLRLFG 99 PF00412.12.ls: domain 1 of 2, from 40 to 99: score 55.8, E = 1.3e-13 *->CagCgkpIydrelvrrAldkvwHpeCFrCavCgkpLgegde.ffekd C+gC++ I dr+ + +A d +wH++C+ C Cg+ Lge +++ + k bm00771 40 CGGCQQNIGDRYFL-KAIDQYWHEDCLSCDLCGCRLGEVGRrLYYKL 85 gsklYCkhDyyklfg<-* g + +C++Dy++lfg bm00771 86 G-RKLCRRDYLRLFG 99 PF00412.12.fs: domain 2 of 2, from 104 to 163: score 84.2, E = 9.9e-24 *->CagCgkpIydrelvrrAldkvwHpeCFrCavCgkpLgegdeffekdg Ca+C+k+I++ e+++r++dkv+H+eCF+Ca C+k+++ gd++ +++ bm00771 104 CASCDKRIRAYEMTMRVKDKVYHLECFKCAACQKHFCVGDRYLLINS 150 sklYCkhDyyklfg<-* ++C++D y + + bm00771 151 -DIVCEQDIYEWTK 163 PF00412.12.ls: domain 2 of 2, from 104 to 163: score 86.2, E = 9.4e-23 *->CagCgkpIydrelvrrAldkvwHpeCFrCavCgkpLgegdeffekdg Ca+C+k+I++ e+++r++dkv+H+eCF+Ca C+k+++ gd++ +++ bm00771 104 CASCDKRIRAYEMTMRVKDKVYHLECFKCAACQKHFCVGDRYLLINS 150 sklYCkhDyyklfg<-* ++C++D y + + bm00771 151 -DIVCEQDIYEWTK 163 //