hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/smart.HMMs.bin Sequence file: /db/iprscan/tmp/20080807/iprscan-20080807-07535568/chunk_1/iprscan-20080807-07535568.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: bm00977 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- SM00385 66.0 4.9e-15 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- SM00385 1/1 57 143 .. 1 90 [] 66.0 4.9e-15 Alignments of top-scoring domains: SM00385: domain 1 of 1, from 57 to 143: score 66.0, E = 4.9e-15 *->dfLrrvakalnldpetlylAvnlldrfLseykvlkgyspsliAaaal ++L ++ ++nl pet++lA lld fL + k + + +s+iA++++ bm00977 57 QWLAKLKYQFNLYPETFALASSLLDGFLATVKAHP-KYLSCIAISCF 102 ylAsKteeippwtktlfhytgylppelayteeeilemekllle<-* +lA+Kt e++ ++ l + +++ ++ ++ +eil+me+++l+ bm00977 103 FLAAKTVEEDERIPVLKVLARDS--FCGCSSSEILRMERIILD 143 //