hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/Pfam.bin Sequence file: /db/iprscan/tmp/20090617/iprscan-20090617-21405628/chunk_1/iprscan-20090617-21405628.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: bm02122 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- PF00076.12.ls RNA recognition motif. (a.k.a. RRM, RBD, or 118.8 1.4e-32 1 PF00076.12.fs RNA recognition motif. (a.k.a. RRM, RBD, or 116.9 5.1e-32 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- PF00076.12.fs 1/1 44 115 .. 1 74 [] 116.9 5.1e-32 PF00076.12.ls 1/1 44 115 .. 1 74 [] 118.8 1.4e-32 Alignments of top-scoring domains: PF00076.12.fs: domain 1 of 1, from 44 to 115: score 116.9, E = 5.1e-32 *->lfVgNLppdtteedLkdlFskfGpiesikivrDttretgrskGfaFV lfVg+L++dt+e+ L++ Fsk+G+i ++ +v+D ret rs+Gf+FV bm02122 44 LFVGGLSFDTNEQSLEQVFSKYGQISEVVVVKD--RETQRSRGFGFV 88 eFedeedAekAldalnGkelggrelrv<-* +Fe+ +dA++A+ a+nGk ++gr +rv bm02122 89 TFENIDDAKDAMMAMNGKSVDGRQIRV 115 PF00076.12.ls: domain 1 of 1, from 44 to 115: score 118.8, E = 1.4e-32 *->lfVgNLppdtteedLkdlFskfGpiesikivrDttretgrskGfaFV lfVg+L++dt+e+ L++ Fsk+G+i ++ +v+D ret rs+Gf+FV bm02122 44 LFVGGLSFDTNEQSLEQVFSKYGQISEVVVVKD--RETQRSRGFGFV 88 eFedeedAekAldalnGkelggrelrv<-* +Fe+ +dA++A+ a+nGk ++gr +rv bm02122 89 TFENIDDAKDAMMAMNGKSVDGRQIRV 115 //