hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/Pfam.bin Sequence file: /db/iprscan/tmp/20090617/iprscan-20090617-21531980/chunk_1/iprscan-20090617-21531980.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: bm02155 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- PF00085.10.ls Thioredoxin 388.7 8e-114 2 PF00085.10.fs Thioredoxin 384.8 1.2e-112 2 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- PF00085.10.fs 1/2 49 154 .. 1 111 [] 192.2 1.1e-54 PF00085.10.ls 1/2 49 154 .. 1 111 [] 194.2 2.9e-55 PF00085.10.fs 2/2 400 506 .. 1 111 [] 192.6 9e-55 PF00085.10.ls 2/2 400 506 .. 1 111 [] 194.5 2.3e-55 Alignments of top-scoring domains: PF00085.10.fs: domain 1 of 2, from 49 to 154: score 192.2, E = 1.1e-54 *->vvlvltdenFdeevak..sdekkpVLVdFYApWCGpCKmlAPeyekl +vl+ltd+nF++ + +++s +++LV+F+ApWCG+CK+lAPeye + bm02155 49 DVLELTDDNFESRISDtgSA--GLMLVEFFAPWCGHCKRLAPEYEAA 93 AqeykdetsdvkfaKVDaDenpdlaskygVrgfPTlkffknGkkvepidy A+ +k+ v++aKVD+++n++++ kygV+g+PTlk+f++G++++ y bm02155 94 ATRLKG---IVPLAKVDCTANTNTCNKYGVSGYPTLKIFRDGEEAG--AY 138 vGaRtkddLvafikkh<-* +G+Rt+d++v+ +kk+ bm02155 139 DGPRTADGIVSHLKKQ 154 PF00085.10.ls: domain 1 of 2, from 49 to 154: score 194.2, E = 2.9e-55 *->vvlvltdenFdeevak..sdekkpVLVdFYApWCGpCKmlAPeyekl +vl+ltd+nF++ + +++s +++LV+F+ApWCG+CK+lAPeye + bm02155 49 DVLELTDDNFESRISDtgSA--GLMLVEFFAPWCGHCKRLAPEYEAA 93 AqeykdetsdvkfaKVDaDenpdlaskygVrgfPTlkffknGkkvepidy A+ +k+ v++aKVD+++n++++ kygV+g+PTlk+f++G++++ y bm02155 94 ATRLKG---IVPLAKVDCTANTNTCNKYGVSGYPTLKIFRDGEEAG--AY 138 vGaRtkddLvafikkh<-* +G+Rt+d++v+ +kk+ bm02155 139 DGPRTADGIVSHLKKQ 154 PF00085.10.fs: domain 2 of 2, from 400 to 506: score 192.6, E = 9e-55 *->vvlvltdenFdeevaksdekkpVLVdFYApWCGpCKmlAPeyeklAq +v+v+++enFde+v++++ k+VL++FYApWCG+CK+l+P+y++l++ bm02155 400 PVKVVVAENFDEIVNNEN--KDVLIEFYAPWCGHCKNLEPKYKELGE 444 eykdetsdvkfaKVDaDenpdlaskygVrgfPTlkffknGkkvepidyvG ++++++ ++++aK+Da++n d++s y+VrgfPT++f +++kk +p++y+G bm02155 445 KLSKDP-NIVIAKMDATAN-DVPSPYEVRGFPTIYFSPANKKLNPKKYEG 492 aRtkddLvafikkh<-* +R+++d++++++++ bm02155 493 GRELSDFISYLQRE 506 PF00085.10.ls: domain 2 of 2, from 400 to 506: score 194.5, E = 2.3e-55 *->vvlvltdenFdeevaksdekkpVLVdFYApWCGpCKmlAPeyeklAq +v+v+++enFde+v++++ k+VL++FYApWCG+CK+l+P+y++l++ bm02155 400 PVKVVVAENFDEIVNNEN--KDVLIEFYAPWCGHCKNLEPKYKELGE 444 eykdetsdvkfaKVDaDenpdlaskygVrgfPTlkffknGkkvepidyvG ++++++ ++++aK+Da++n d++s y+VrgfPT++f +++kk +p++y+G bm02155 445 KLSKDP-NIVIAKMDATAN-DVPSPYEVRGFPTIYFSPANKKLNPKKYEG 492 aRtkddLvafikkh<-* +R+++d++++++++ bm02155 493 GRELSDFISYLQRE 506 //