hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/Pfam.bin Sequence file: /db/iprscan/tmp/20080807/iprscan-20080807-12332184/chunk_1/iprscan-20080807-12332184.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: bm02392 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- PF08375.1.ls Proteasome regulatory subunit C-terminal 162.4 1.1e-45 1 PF08375.1.fs Proteasome regulatory subunit C-terminal 160.5 4.1e-45 1 PF01399.17.ls PCI domain 116.4 7.8e-32 1 PF01399.17.fs PCI domain 114.6 2.4e-31 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- PF01399.17.fs 1/1 364 468 .. 1 135 [] 114.6 2.4e-31 PF01399.17.ls 1/1 364 468 .. 1 135 [] 116.4 7.8e-32 PF08375.1.fs 1/1 471 538 .. 1 69 [] 160.5 4.1e-45 PF08375.1.ls 1/1 471 538 .. 1 69 [] 162.4 1.1e-45 Alignments of top-scoring domains: PF01399.17.fs: domain 1 of 1, from 364 to 468: score 114.6, E = 2.4e-31 *->payrdLleafysgdlsdfeeiladhvmAKalkGwqkkeellldpgla +y+ L++a+++g+l+ f++ l ++ e ++ +g++ bm02392 364 MPYFLLTQAVRTGNLAKFNQVLDQF------------GEKFQADGTY 398 ekvwlegdkhledLrrkirelnlrrlakftysapYssislsdlakllgls + ++ +Lr++++++ +r++++ +Ys+isl+d+a++l+l+ bm02392 399 T--------LIIRLRHNVIKTGVRMISL-----SYSRISLADIAQKLQLD 435 vvedvlqdevEkilsklIrdglirgkIDqvngivvvse<-* ++ +++E+i++k+Irdg i+++I++++g+v +e bm02392 436 SP-----EDAEFIVAKAIRDGVIEASINHEKGYVQSKE 468 PF01399.17.ls: domain 1 of 1, from 364 to 468: score 116.4, E = 7.8e-32 *->payrdLleafysgdlsdfeeiladhvmAKalkGwqkkeellldpgla +y+ L++a+++g+l+ f++ l ++ e ++ +g++ bm02392 364 MPYFLLTQAVRTGNLAKFNQVLDQF------------GEKFQADGTY 398 ekvwlegdkhledLrrkirelnlrrlakftysapYssislsdlakllgls + ++ +Lr++++++ +r++++ +Ys+isl+d+a++l+l+ bm02392 399 T--------LIIRLRHNVIKTGVRMISL-----SYSRISLADIAQKLQLD 435 vvedvlqdevEkilsklIrdglirgkIDqvngivvvse<-* ++ +++E+i++k+Irdg i+++I++++g+v +e bm02392 436 SP-----EDAEFIVAKAIRDGVIEASINHEKGYVQSKE 468 PF08375.1.fs: domain 1 of 1, from 471 to 538: score 160.5, E = 4.1e-45 *->DiYsTnEPqqaFhkRIaFClqLHneaVkAMRYPpkkerkelesaeer DiYsT+EPq aFh+RI+FCl++Hn++VkAMR+Ppk+++k+lesaeer bm02392 471 DIYSTREPQLAFHQRISFCLDIHNMSVKAMRFPPKSYNKDLESAEER 517 ReReqeelelakeldegSDdDD<-* ReReq++le+ake++e+ DdD+ bm02392 518 REREQQDLEFAKEMAED-DDDS 538 PF08375.1.ls: domain 1 of 1, from 471 to 538: score 162.4, E = 1.1e-45 *->DiYsTnEPqqaFhkRIaFClqLHneaVkAMRYPpkkerkelesaeer DiYsT+EPq aFh+RI+FCl++Hn++VkAMR+Ppk+++k+lesaeer bm02392 471 DIYSTREPQLAFHQRISFCLDIHNMSVKAMRFPPKSYNKDLESAEER 517 ReReqeelelakeldegSDdDD<-* ReReq++le+ake++e+ DdD+ bm02392 518 REREQQDLEFAKEMAED-DDDS 538 //