hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/smart.HMMs.bin Sequence file: /db/iprscan/tmp/20080807/iprscan-20080807-12332184/chunk_1/iprscan-20080807-12332184.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: bm02392 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- SM00753 247.9 8.1e-70 1 SM00088 105.6 5.7e-27 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- SM00753 1/1 227 399 .. 1 186 [] 247.9 8.1e-70 SM00088 1/1 399 489 .. 1 92 [] 105.6 5.7e-27 Alignments of top-scoring domains: SM00753: domain 1 of 1, from 227 to 399: score 247.9, E = 8.1e-70 *->ylealelrstllrelrtadlKkdelgllvlvnLllSkiYlklnnldl +++ +rs+l+++lrta+l++d +g+++l+nLll ++Yl+++++d+ bm02392 227 LDKLDVVRSFLHARLRTATLRHDADGQATLLNLLL-RNYLHYSLYDQ 272 akallskaarteraslansayappsqqarydyylGrihaleldyktAfsy a++l+sk+ ++e a ++++ary+yy Gri+a++l+y++A bm02392 273 AEKLVSKSVFPE--------QANNNEWARYLYYTGRIKAIQLEYSEARRT 314 ffeAfrkcpelgsakgfrrqiLkYlilvkLLlgseiiPdrsllrqkkllk + A+rk+p++++ +gf++++ k+li+v+LLlg+ iPdr ++rq+ l + bm02392 315 MTNALRKAPQHTA-VGFKQTVHKLLIVVELLLGE--IPDRLQFRQPSLKR 361 tliaykTdlaqAvrnGdLklFekaLqqyedeflkdgiyl<-* +l +y+ l+qAvr G+L++F+++L q+ +f++dg+y+ bm02392 362 SLMPYF-LLTQAVRTGNLAKFNQVLDQFGEKFQADGTYT 399 SM00088: domain 1 of 1, from 399 to 489: score 105.6, E = 5.7e-27 *->qhverLqrkiretnllqlsepYPssislsdlakllglsvpeevEklv +++ rL++++++t +++s +Y s+isl d+a++l+l++pe++E +v bm02392 399 TLIIRLRHNVIKTGVRMISLSY-SRISLADIAQKLQLDSPEDAEFIV 444 skaIrdgeisakIDqvngivefeevdpryltsnqlaqlaerlkkl<-* +kaIrdg i+a+I++++g+v e ++y+t++++ ++++r++++ bm02392 445 AKAIRDGVIEASINHEKGYVQSKEMIDIYSTREPQLAFHQRISFC 489 //