hmmpfam - search one or more sequences against HMM database
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file:                 /db/iprscan/data/smart.HMMs.bin
Sequence file:            /db/iprscan/tmp/20080807/iprscan-20080807-12384863/chunk_1/iprscan-20080807-12384863.nocrc
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query sequence: bm02405
Accession:      [none]
Description:    [none]

Scores for sequence family classification (score includes all domains):
Model    Description                                    Score    E-value  N 
-------- -----------                                    -----    ------- ---
SM00320                                                 277.7      9e-79   8
SM00256                                                  42.3    6.3e-08   1

Parsed for domains:
Model    Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
-------- ------- ----- -----    ----- -----      -----  -------
SM00256    1/1     201   241 ..     1    41 []    42.3  6.3e-08
SM00320    1/8     286   324 ..     1    46 []    35.9  5.5e-06
SM00320    2/8     327   364 ..     1    46 []    39.8  3.7e-07
SM00320    3/8     367   404 ..     1    46 []    44.6  1.3e-08
SM00320    4/8     407   444 ..     1    46 []    36.4  3.7e-06
SM00320    5/8     447   484 ..     1    46 []    44.1  1.8e-08
SM00320    6/8     487   524 ..     1    46 []    30.1  0.00031
SM00320    7/8     527   567 ..     1    46 []    46.2  4.2e-09
SM00320    8/8     570   618 ..     1    46 []     0.5  4.1e+02

Alignments of top-scoring domains:
SM00256: domain 1 of 1, from 201 to 241: score 42.3, E = 6.3e-08
                   *->LPieileeIlskLdpkdllrlrkVsrkwrslidshdfwfkr<-*
                      LP e+ + +ls+L+pkdll++ +++r wr l  ++ +w+++   
     bm02405   201    LPKELALYVLSFLEPKDLLQAAQTCRYWRILAEDNLLWREK    241  

SM00320: domain 1 of 8, from 286 to 324: score 35.9, E = 5.5e-06
                   *->t.kllrtlkgHtgespVtsvafspdggssdspnllasgs.DgtirlW
                      + k  ++lkgH++ + +t+++f+ +        +++sgs+D+t+++W
     bm02405   286    ElKSPKVLKGHDD-HVITCLQFCGN--------RIVSGSdDNTLKVW 323  

                   d<-*
                   +   
     bm02405   324 S    324  

SM00320: domain 2 of 8, from 327 to 364: score 39.8, E = 3.7e-07
                   *->t.kllrtlkgHtgespVtsvafspdggssdspnllasgs.DgtirlW
                      t+k+lrtl gHtg  +V+s +  ++        +++sgs+D+t+++W
     bm02405   327    TgKCLRTLVGHTG--GVWSSQMRDN--------IIISGStDRTLKVW 363  

                   d<-*
                   +   
     bm02405   364 N    364  

SM00320: domain 3 of 8, from 367 to 404: score 44.6, E = 1.3e-08
                   *->t.kllrtlkgHtgespVtsvafspdggssdspnllasgs.DgtirlW
                      t+++++tl gHt+   V+++  +          +++sgs+D t+r+W
     bm02405   367    TgECIHTLYGHTS--TVRCMHLHEK--------RVVSGSrDATLRVW 403  

                   d<-*
                   d   
     bm02405   404 D    404  

SM00320: domain 4 of 8, from 407 to 444: score 36.4, E = 3.7e-06
                   *->t.kllrtlkgHtgespVtsvafspdggssdspnllasgs.DgtirlW
                      t+++l++l gH +  +V++v+++          +++sg  D  +++W
     bm02405   407    TgQCLHVLMGHVA--AVRCVQYDGR--------RVVSGAyDFMVKVW 443  

                   d<-*
                   d   
     bm02405   444 D    444  

SM00320: domain 5 of 8, from 447 to 484: score 44.1, E = 1.8e-08
                   *->t.kllrtlkgHtgespVtsvafspdggssdspnllasgs.DgtirlW
                      t ++l+tl+gHt+  +V+s++f+          +++sgs D +ir+W
     bm02405   447    TeTCLHTLQGHTN--RVYSLQFDGI--------HVVSGSlDTSIRVW 483  

                   d<-*
                   d   
     bm02405   484 D    484  

SM00320: domain 6 of 8, from 487 to 524: score 30.1, E = 0.00031
                   *->t.kllrtlkgHtgespVtsvafspdggssdspnllasgs.DgtirlW
                      t+++++tl+gH++    +++   ++        +l+sg  D+t+++W
     bm02405   487    TgNCIHTLTGHQS--LTSGMELKDN--------ILVSGNaDSTVKIW 523  

                   d<-*
                   d   
     bm02405   524 D    524  

SM00320: domain 7 of 8, from 527 to 567: score 46.2, E = 4.2e-09
                   *->t.kllrtlk...gHtgespVtsvafspdggssdspnllasgs.Dgti
                      t+++l+tl++++ H++  +Vt+++f+ +        +++++s+Dgt+
     bm02405   527    TgQCLQTLQgpnKHQS--AVTCLQFNKN--------FVITSSdDGTV 563  

                   rlWd<-*
                   +lWd   
     bm02405   564 KLWD    567  

SM00320: domain 8 of 8, from 570 to 618: score 0.5, E = 4.1e+02
                   *->t.kllrtlk.....gHtgespVtsvafspdggssdspnllasgs.Dg
                      t++ +r l + +++g  g   V+ ++ s +        + a+gs++g
     bm02405   570    TgEFIRNLVtlesgGSGG--VVWRIRASNTK------LVCAVGSrNG 608  

                   t....irlWd<-*
                   t+++++ + d   
     bm02405   609 TeetkLLVLD    618  

//