hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/Pfam.bin Sequence file: /db/iprscan/tmp/20090617/iprscan-20090617-22373783/chunk_1/iprscan-20090617-22373783.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: bm02547 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- PF08227.2.fs DASH complex subunit Hsk3 like 71.4 2.9e-20 1 PF08227.2.ls DASH complex subunit Hsk3 like 73.4 6.6e-19 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- PF08227.2.fs 1/1 184 230 .. 1 47 [] 71.4 2.9e-20 PF08227.2.ls 1/1 184 230 .. 1 47 [] 73.4 6.6e-19 Alignments of top-scoring domains: PF08227.2.fs: domain 1 of 1, from 184 to 230: score 71.4, E = 2.9e-20 *->qRqysqLasqLaqLqaNLadTeelLettsvQaeawlirkLGkihgSl +R+++qL++++++L++N+a+++e+Le++s+Q+++w++++L+++++++ bm02547 184 AREKNQLILENEALGRNTAQLSEQLERMSIQCDVWRSKFLASRVMAD 230 <-* bm02547 - - PF08227.2.ls: domain 1 of 1, from 184 to 230: score 73.4, E = 6.6e-19 *->qRqysqLasqLaqLqaNLadTeelLettsvQaeawlirkLGkihgSl +R+++qL++++++L++N+a+++e+Le++s+Q+++w++++L+++++++ bm02547 184 AREKNQLILENEALGRNTAQLSEQLERMSIQCDVWRSKFLASRVMAD 230 <-* bm02547 - - //