hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/Pfam.bin Sequence file: /db/iprscan/tmp/20080807/iprscan-20080807-13014278/chunk_1/iprscan-20080807-13014278.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: bm02581 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- PF08368.2.fs FAST kinase-like protein, subdomain 2 131.5 3.1e-38 1 PF08368.2.ls FAST kinase-like protein, subdomain 2 133.4 5.7e-37 1 PF06743.5.ls FAST kinase-like protein, subdomain 1 101.2 2.8e-27 1 PF06743.5.fs FAST kinase-like protein, subdomain 1 99.3 7.3e-27 1 PF08373.1.fs RAP domain 61.5 3.9e-16 1 PF08373.1.ls RAP domain 63.4 7.1e-16 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- PF06743.5.fs 1/1 251 319 .. 1 75 [] 99.3 7.3e-27 PF06743.5.ls 1/1 251 319 .. 1 75 [] 101.2 2.8e-27 PF08368.2.fs 1/1 327 418 .. 1 95 [] 131.5 3.1e-38 PF08368.2.ls 1/1 327 418 .. 1 95 [] 133.4 5.7e-37 PF08373.1.fs 1/1 453 510 .. 1 70 [] 61.5 3.9e-16 PF08373.1.ls 1/1 453 510 .. 1 70 [] 63.4 7.1e-16 Alignments of top-scoring domains: PF06743.5.fs: domain 1 of 1, from 251 to 319: score 99.3, E = 7.3e-27 *->vaalLlpFgrLNYkykPpnkeeFfsklvqkLlreLhtlsqYPeslln v++l+lpFgrLNY+ P + ++F+++l+++L+re ++++ P++++n bm02581 251 VQKLVLPFGRLNYL--PLE-QQFMPCLERILARE-AGVA--PLATVN 291 lvwSLclleyfPeellnkVlspdFlqrL<-* +++SLc+l+++P+++l++V+sp+F++++ bm02581 292 ILMSLCQLRCLPFRALHFVFSPGFINYI 319 PF06743.5.ls: domain 1 of 1, from 251 to 319: score 101.2, E = 2.8e-27 *->vaalLlpFgrLNYkykPpnkeeFfsklvqkLlreLhtlsqYPeslln v++l+lpFgrLNY+ P + ++F+++l+++L+re ++++ P++++n bm02581 251 VQKLVLPFGRLNYL--PLE-QQFMPCLERILARE-AGVA--PLATVN 291 lvwSLclleyfPeellnkVlspdFlqrL<-* +++SLc+l+++P+++l++V+sp+F++++ bm02581 292 ILMSLCQLRCLPFRALHFVFSPGFINYI 319 PF08368.2.fs: domain 1 of 1, from 327 to 418: score 131.5, E = 3.1e-38 *->rvrkkLlqLnaavkLEcPeYkgplLptryqvpqfpqplpkkrtplDs vr++L L++av+LE P+Y+gp+Lp+r+qvp+fpqpl+++r+++++ bm02581 327 IVRRYLSLLDTAVELELPGYRGPRLPRRQQVPIFPQPLITDRARCKY 373 ssqkellevyLLkeLLGgeqyfkhsvttPygytiDfEvvLDkngkpLP<- s++++++e+ L++LLG+e +++++ t+P+gy++Df+ + +++g++LP bm02581 374 SHKDIVAEG--LRQLLGEE-KYRQDLTVPPGYCTDFLLCASSSGAVLP 418 * bm02581 - - PF08368.2.ls: domain 1 of 1, from 327 to 418: score 133.4, E = 5.7e-37 *->rvrkkLlqLnaavkLEcPeYkgplLptryqvpqfpqplpkkrtplDs vr++L L++av+LE P+Y+gp+Lp+r+qvp+fpqpl+++r+++++ bm02581 327 IVRRYLSLLDTAVELELPGYRGPRLPRRQQVPIFPQPLITDRARCKY 373 ssqkellevyLLkeLLGgeqyfkhsvttPygytiDfEvvLDkngkpLP<- s++++++e+ L++LLG+e +++++ t+P+gy++Df+ + +++g++LP bm02581 374 SHKDIVAEG--LRQLLGEE-KYRQDLTVPPGYCTDFLLCASSSGAVLP 418 * bm02581 - - PF08373.1.fs: domain 1 of 1, from 453 to 510: score 61.5, E = 3.9e-16 *->IeidGpshfyrLinqanskslkydlintgntklKkRlLsalGykVIs +++ +++hf+r +++ l +g+ +l+ R+L +Gy++ + bm02581 453 LVLRERWHFCR-----DGRVL------LGSRALRERHLGLMGYQLLP 488 IpyyEWnkmlktelqKkeYlkkk<-* +p+ E+++ ++ q k+Yl++k bm02581 489 LPFEELES-QRGLPQLKSYLRQK 510 PF08373.1.ls: domain 1 of 1, from 453 to 510: score 63.4, E = 7.1e-16 *->IeidGpshfyrLinqanskslkydlintgntklKkRlLsalGykVIs +++ +++hf+r +++ l +g+ +l+ R+L +Gy++ + bm02581 453 LVLRERWHFCR-----DGRVL------LGSRALRERHLGLMGYQLLP 488 IpyyEWnkmlktelqKkeYlkkk<-* +p+ E+++ ++ q k+Yl++k bm02581 489 LPFEELES-QRGLPQLKSYLRQK 510 //