hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/smart.HMMs.bin Sequence file: /db/iprscan/tmp/20080807/iprscan-20080807-13481167/chunk_1/iprscan-20080807-13481167.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: bm02726 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- SM00100 236.9 1.7e-66 2 SM00394 56.8 2.9e-12 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- SM00394 1/1 38 75 .. 1 39 [] 56.8 2.9e-12 SM00100 1/2 150 266 .. 1 123 [] 114.6 1.1e-29 SM00100 2/2 268 387 .. 1 123 [] 122.3 5.5e-32 Alignments of top-scoring domains: SM00394: domain 1 of 1, from 38 to 75: score 56.8, E = 2.9e-12 *->hglqaLLedltveVlraqPsDlvqFaadYFnekLeeqRa<-* hg+q++L+d++v +++++P++++ F++++F ekLe+++ bm02726 38 HGIQQVLKDCIVHLCISKPERPMKFLREHF-EKLEKEEN 75 SM00100: domain 1 of 2, from 150 to 266: score 114.6, E = 1.1e-29 *->lfkaldaeelreladalepvrypaGevifrqGdpgdsfYiivsGeve lf++ld+ e+++++da++pv aGe++++qG gd+fY++ +Gev+ bm02726 150 LFAHLDDNERSDIFDAMFPVTHIAGETVIQQGNEGDNFYVVDQGEVD 196 vyktrlstledgreqilatlgpGdfFGElall...rrarsaaavalvela vy+ + +++ ++ G +FGElal+ +++ra+++ a++ ++l+ bm02726 197 VYVN---------GEWVTNISEGGSFGELALIygtPRAATVKAKTDLKLW 237 tllridferflqllpenpqlllelllell<-* ++r++++r+l+ + ++++++e++l+ + bm02726 238 GIDRDSYRRILMGSTLRKRKMYEEFLSKV 266 SM00100: domain 2 of 2, from 268 to 387: score 122.3, E = 5.5e-32 *->lfkaldaeelreladalepvrypaGevifrqGdpgdsfYiivsGeve ++++l++ e++ +adalepv +++Ge i+ qG+pgd+fYii +G++ bm02726 268 ILESLEKWERLTVADALEPVQFEDGEKIVVQGEPGDDFYIITEGTAS 314 vyktrlstledgreqilatlgpGdfFGElall.rrarsaaavalvelatl v+++ ++ + +++++lgp d+FGE+all +r+r+a++va+ + ++ bm02726 315 VLQR---RSPNEEYVEVGRLGPSDYFGEIALLlNRPRAATVVAR-GPLKC 360 lridferflqllpenpqlllelllell<-* +++d+ rf++ l+ ++++l+++++++ bm02726 361 VKLDRPRFERVLGPCSEILKRNIQRYN 387 //