hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/Pfam.bin Sequence file: /db/iprscan/tmp/20080807/iprscan-20080807-14114286/chunk_1/iprscan-20080807-14114286.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: bm02855 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- PF00400.22.ls WD domain, G-beta repeat 156.7 5.4e-44 6 PF00400.22.fs WD domain, G-beta repeat 148.0 2.3e-41 6 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- PF00400.22.fs 1/6 56 92 .. 1 33 [. 16.8 0.00093 PF00400.22.fs 2/6 101 139 .. 1 38 [] 25.0 4.5e-06 PF00400.22.ls 2/6 101 139 .. 1 38 [] 27.0 6.4e-05 PF00400.22.ls 3/6 143 180 .. 1 38 [] 26.8 7e-05 PF00400.22.fs 3/6 150 180 .. 7 38 .] 25.6 3e-06 PF00400.22.ls 4/6 185 222 .. 1 38 [] 22.3 0.0016 PF00400.22.fs 4/6 185 222 .. 1 38 [] 20.4 8.8e-05 PF00400.22.fs 5/6 266 303 .. 1 38 [] 12.7 0.013 PF00400.22.ls 6/6 307 345 .. 1 38 [] 49.5 1e-11 PF00400.22.fs 6/6 307 345 .. 1 38 [] 47.5 2e-12 Alignments of top-scoring domains: PF00400.22.fs: domain 1 of 6, from 56 to 92: score 16.8, E = 0.00093 *->geck.vl.gHtstVtcvafspd..sgpllasgSrDgt<-* ++ + +gHt +V ++afs +++g +l+s++ Dg+ bm02855 56 RQTPlTCsGHTRPVVDLAFSGItpYGYFLISACKDGK 92 PF00400.22.fs: domain 2 of 6, from 101 to 139: score 25.0, E = 4.5e-06 *->geck.vl.gHtstVtcvafspdsgpllasgSrDgtikiWd<-* g+ ++++ gH+++V+ + d + a++ +D t k+Wd bm02855 101 GDWIgTFlGHKGAVWGATLNKD-ATKAATAAADFTAKVWD 139 PF00400.22.ls: domain 2 of 6, from 101 to 139: score 27.0, E = 6.4e-05 *->geck.vl.gHtstVtcvafspdsgpllasgSrDgtikiWd<-* g+ ++++ gH+++V+ + d + a++ +D t k+Wd bm02855 101 GDWIgTFlGHKGAVWGATLNKD-ATKAATAAADFTAKVWD 139 PF00400.22.ls: domain 3 of 6, from 143 to 180: score 26.8, E = 7e-05 *->geck.vlgHtstVtcvafspdsgpllasgSrDgtikiWd<-* g+ + +l+H++ V v+f +d +++l++g+ D+ ++i+d bm02855 143 GDELmTLAHKHIVKTVDFTQD-SNYLLTGGQDKLLRIYD 180 PF00400.22.fs: domain 3 of 6, from 150 to 180: score 25.6, E = 3e-06 *->gHtstVtcvafspdsgpllasgSrDgtikiWd<-* +H++ V v+f +d +++l++g+ D+ ++i+d bm02855 150 AHKHIVKTVDFTQD-SNYLLTGGQDKLLRIYD 180 PF00400.22.ls: domain 4 of 6, from 185 to 222: score 22.3, E = 0.0016 *->geck.vl.gHtstVtcvafspdsgpllasgSrDgtikiWd<-* ++++gHts++ ++ + ++++s+ + +t+++Wd bm02855 185 EAEPkEIsGHTSGIKKALWCSE-DKQILSADD-KTVRLWD 222 PF00400.22.fs: domain 4 of 6, from 185 to 222: score 20.4, E = 8.8e-05 *->geck.vl.gHtstVtcvafspdsgpllasgSrDgtikiWd<-* ++++gHts++ ++ + ++++s+ + +t+++Wd bm02855 185 EAEPkEIsGHTSGIKKALWCSE-DKQILSADD-KTVRLWD 222 PF00400.22.fs: domain 5 of 6, from 266 to 303: score 12.7, E = 0.013 *->geck.vl.gHtstVtcvafspdsgpllasgSrDgtikiWd<-* ++++++++ +t+++ + +p+ ++l+ g++D +++ +d bm02855 266 LDPIkSFeAP-ATINSASLHPE-KEFLVAGGEDFKLYKYD 303 PF00400.22.ls: domain 6 of 6, from 307 to 345: score 49.5, E = 1e-11 *->geck.vl.gHtstVtcvafspdsgpllasgSrDgtikiWd<-* ge + +++gH +++ cv+fspd g+l asgS+Dgt+++W bm02855 307 GEELeSYkGHFGPIHCVRFSPD-GELYASGSEDGTLRLWQ 345 PF00400.22.fs: domain 6 of 6, from 307 to 345: score 47.5, E = 2e-12 *->geck.vl.gHtstVtcvafspdsgpllasgSrDgtikiWd<-* ge + +++gH +++ cv+fspd g+l asgS+Dgt+++W bm02855 307 GEELeSYkGHFGPIHCVRFSPD-GELYASGSEDGTLRLWQ 345 //