hmmpfam - search one or more sequences against HMM database
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file:                 /db/iprscan/data/smart.HMMs.bin
Sequence file:            /db/iprscan/tmp/20080807/iprscan-20080807-14293889/chunk_1/iprscan-20080807-14293889.nocrc
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query sequence: bm02881
Accession:      [none]
Description:    [none]

Scores for sequence family classification (score includes all domains):
Model     Description                                   Score    E-value  N 
--------  -----------                                   -----    ------- ---
SM00233                                                  45.5    7.1e-09   1

Parsed for domains:
Model     Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
--------  ------- ----- -----    ----- -----      -----  -------
SM00233     1/1     183   433 ..     1    82 []    45.5  7.1e-09

Alignments of top-scoring domains:
SM00233: domain 1 of 1, from 183 to 433: score 45.5, E = 7.1e-09
                   *->vikeGwLlkks..................k.swkkryfvLfngvLly
                       + + w++++  +++++++ + ++++ +  ++w ++y++L++++L++
     bm02881   183    CQQQSWVRVYDvkgppthrlscgqspyteTtTWERKYCILTDSQLVL 229  

                   yksk..............................................
                     ++++ + ++++++++++++++  +++ + +++++ ++ ++++ ++ + 
     bm02881   230 LNKEkeipveggqeqqtdstkgrclrrtvsvpsegqfpeyppegatklev 279  

                   ..................................................
                   + ++++++++ +++++++++++ ++ ++++ + ++  +++ +++ +++++
     bm02881   280 paersprrrsisgtstsekpnsmdtantspfkvpgffskrlkgsikrtks 329  

                   ..............................kpkgsipLsgc.svre.p..
                   +++ +++++ + ++ +++++++++ ++ +++ +++  Ls c++v++ + +
     bm02881   330 qskldrntsfrlpslrstddrsrglpklkeSRSHESLLSPCsTVEClDlg 379  

                   ...................cFeivt.drtlllqAeseeereeWvealqsa
                   ++++ + ++ +++  + + cFe+++ +++  ++++s++er++W+e l++ 
     bm02881   380 rgepvsvkplhssilgqdfCFEVTYlSGSKCFSCNSASERDKWMENLRRT 429  

                   iaka<-*
                   ++++   
     bm02881   430 VQPN    433  

//