hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/Pfam.bin Sequence file: /db/iprscan/tmp/20080807/iprscan-20080807-15113940/chunk_1/iprscan-20080807-15113940.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: bm03010 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- PF00076.12.fs RNA recognition motif. (a.k.a. RRM, RBD, or 84.8 5.1e-23 1 PF00076.12.ls RNA recognition motif. (a.k.a. RRM, RBD, or 86.8 6.3e-23 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- PF00076.12.fs 1/1 396 467 .. 1 74 [] 84.8 5.1e-23 PF00076.12.ls 1/1 396 467 .. 1 74 [] 86.8 6.3e-23 Alignments of top-scoring domains: PF00076.12.fs: domain 1 of 1, from 396 to 467: score 84.8, E = 5.1e-23 *->lfVgNLppdtteedLkdlFskfGpiesikivrDttretgrskGfaFV +f+g+L ++++++ L ++Fs f++++ +k++rD + tg++kG++FV bm03010 396 IFCGDLGNEVNDDILARAFSRFPSFLKAKVIRD--KRTGKTKGYGFV 440 eFedeedAekAldalnGkelggrelrv<-* F+d++d +A++++nGk++g+r+++ bm03010 441 SFKDPSDYVRAMREMNGKYVGSRPIKL 467 PF00076.12.ls: domain 1 of 1, from 396 to 467: score 86.8, E = 6.3e-23 *->lfVgNLppdtteedLkdlFskfGpiesikivrDttretgrskGfaFV +f+g+L ++++++ L ++Fs f++++ +k++rD + tg++kG++FV bm03010 396 IFCGDLGNEVNDDILARAFSRFPSFLKAKVIRD--KRTGKTKGYGFV 440 eFedeedAekAldalnGkelggrelrv<-* F+d++d +A++++nGk++g+r+++ bm03010 441 SFKDPSDYVRAMREMNGKYVGSRPIKL 467 //