hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/Pfam.bin Sequence file: /db/iprscan/tmp/20080807/iprscan-20080807-15284754/chunk_1/iprscan-20080807-15284754.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: bm03080 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- PF00076.12.fs RNA recognition motif. (a.k.a. RRM, RBD, or 182.3 1.1e-51 3 PF00076.12.ls RNA recognition motif. (a.k.a. RRM, RBD, or 157.3 3.7e-44 2 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- PF00076.12.fs 1/3 10 44 .. 40 74 .] 28.9 2.4e-07 PF00076.12.ls 1/2 106 176 .. 1 74 [] 66.5 8.2e-17 PF00076.12.fs 2/3 106 176 .. 1 74 [] 64.5 2.5e-17 PF00076.12.ls 2/2 540 609 .. 1 74 [] 90.8 3.8e-24 PF00076.12.fs 3/3 540 609 .. 1 74 [] 88.9 3.6e-24 Alignments of top-scoring domains: PF00076.12.fs: domain 1 of 3, from 10 to 44: score 28.9, E = 2.4e-07 *->rskGfaFVeFedeedAekAldalnGkelggrelrv<-* + kG+a VeF+ ee+++kA + ln++ l gr+l+v bm03080 10 KKKGCAVVEFKMEESMKKAAEVLNKHSLSGRPLKV 44 PF00076.12.ls: domain 1 of 2, from 106 to 176: score 66.5, E = 8.2e-17 *->lfVgNLppdtteedLkdlFskfGpiesikivrDttretgrskGfaFV +fV NL + + +++Lk+ Fs G +++++i D g+s+G + V bm03080 106 VFVANLDYKVGWKKLKEVFSMAGVVVRADILED---KDGKSRGIGTV 149 eFedeedAekAldalnGkelggrelrv<-* +Fe++ +A A++ nG+ l +r+++v bm03080 150 TFEQSIEAVQAISMFNGQLLFDRPMHV 176 PF00076.12.fs: domain 2 of 3, from 106 to 176: score 64.5, E = 2.5e-17 *->lfVgNLppdtteedLkdlFskfGpiesikivrDttretgrskGfaFV +fV NL + + +++Lk+ Fs G +++++i D g+s+G + V bm03080 106 VFVANLDYKVGWKKLKEVFSMAGVVVRADILED---KDGKSRGIGTV 149 eFedeedAekAldalnGkelggrelrv<-* +Fe++ +A A++ nG+ l +r+++v bm03080 150 TFEQSIEAVQAISMFNGQLLFDRPMHV 176 PF00076.12.ls: domain 2 of 2, from 540 to 609: score 90.8, E = 3.8e-24 *->lfVgNLppdtteedLkdlFskfGpiesikivrDttretgrskGfaFV +fV+NLp+d t++ Lkd F+++G ++ ++i+ e+g+skG++ V bm03080 540 IFVRNLPFDFTWKMLKDKFNECGHVLYADIKM----ENGKSKGCGVV 582 eFedeedAekAldalnGkelggrelrv<-* +Fe++e Ae+A + +nG++l gre+ v bm03080 583 KFESPEVAERACRMMNGMKLSGREIDV 609 PF00076.12.fs: domain 3 of 3, from 540 to 609: score 88.9, E = 3.6e-24 *->lfVgNLppdtteedLkdlFskfGpiesikivrDttretgrskGfaFV +fV+NLp+d t++ Lkd F+++G ++ ++i+ e+g+skG++ V bm03080 540 IFVRNLPFDFTWKMLKDKFNECGHVLYADIKM----ENGKSKGCGVV 582 eFedeedAekAldalnGkelggrelrv<-* +Fe++e Ae+A + +nG++l gre+ v bm03080 583 KFESPEVAERACRMMNGMKLSGREIDV 609 //