hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/Pfam.bin Sequence file: /db/iprscan/tmp/20080807/iprscan-20080807-17221143/chunk_1/iprscan-20080807-17221143.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: bm03735 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- PF00789.11.fs UBX domain 34.7 3.8e-09 2 PF00789.11.ls UBX domain 33.2 8.6e-07 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- PF00789.11.fs 2/2 375 454 .. 1 92 [] 31.3 3.4e-08 PF00789.11.ls 1/1 375 454 .. 1 92 [] 33.2 8.6e-07 Alignments of top-scoring domains: PF00789.11.fs: domain 2 of 2, from 375 to 454: score 31.3, E = 3.4e-08 *->skaedvcrlqiRlPDGsrlvrrFnssdklqdvydfVdsnrddadepe ++++++ l++ +PD++ l+ F++s+++ d++dfV+s++ + + bm03735 375 LERYPKVALRVLFPDRYVLQGFFRPSETVGDLRDFVRSHLGNPELS- 420 VyPdYHdyeFsLltnfPRrlltdddesktLkeagllpnstlvlep<-* F L + P+ +l+d +tL +a+l+p + + l bm03735 421 ---------FYLFITPPKTVLDDHT--QTLFQANLFPAALVHLGA 454 PF00789.11.ls: domain 1 of 1, from 375 to 454: score 33.2, E = 8.6e-07 *->skaedvcrlqiRlPDGsrlvrrFnssdklqdvydfVdsnrddadepe ++++++ l++ +PD++ l+ F++s+++ d++dfV+s++ + + bm03735 375 LERYPKVALRVLFPDRYVLQGFFRPSETVGDLRDFVRSHLGNPELS- 420 VyPdYHdyeFsLltnfPRrlltdddesktLkeagllpnstlvlep<-* F L + P+ +l+d +tL +a+l+p + + l bm03735 421 ---------FYLFITPPKTVLDDHT--QTLFQANLFPAALVHLGA 454 //