hmmpfam - search one or more sequences against HMM database
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file:                 /db/iprscan/data/smart.HMMs.bin
Sequence file:            /db/iprscan/tmp/20080807/iprscan-20080807-17275613/chunk_1/iprscan-20080807-17275613.nocrc
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query sequence: bm03741
Accession:      [none]
Description:    [none]

Scores for sequence family classification (score includes all domains):
Model    Description                                    Score    E-value  N 
-------- -----------                                    -----    ------- ---
SM00256                                                  25.6     0.0067   1

Parsed for domains:
Model    Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
-------- ------- ----- -----    ----- -----      -----  -------
SM00256    1/1     370   410 ..     1    41 []    25.6   0.0067

Alignments of top-scoring domains:
SM00256: domain 1 of 1, from 370 to 410: score 25.6, E = 0.0067
                   *->LPieileeIlskLdpkdllrlrkVsrkwrslidshdfwfkr<-*
                      LP+e+ + I+  Ld ++ l+l+ V+r + ++ ++  +w+ +   
     bm03741   370    LPLELKLRIFRLLDVRSVLSLSAVCRDLFTASNDPLLWRFL    410  

//