hmmpfam - search one or more sequences against HMM database
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file:                 /db/iprscan/data/smart.HMMs.bin
Sequence file:            /db/iprscan/tmp/20080807/iprscan-20080807-17554824/chunk_1/iprscan-20080807-17554824.nocrc
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query sequence: bm03854
Accession:      [none]
Description:    [none]

Scores for sequence family classification (score includes all domains):
Model     Description                                   Score    E-value  N 
--------  -----------                                   -----    ------- ---
SM00739                                                  50.9    1.7e-10   2
SM00443                                                  34.6    1.3e-05   1

Parsed for domains:
Model     Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
--------  ------- ----- -----    ----- -----      -----  -------
SM00443     1/1     161   207 ..     1    48 []    34.6  1.3e-05
SM00739     1/2     239   266 ..     1    28 []    26.1   0.0048
SM00739     2/2     414   441 ..     1    28 []    24.7    0.012

Alignments of top-scoring domains:
SM00443: domain 1 of 1, from 161 to 207: score 34.6, E = 1.3e-05
                   *->istsniGaklLekMGWkeGkGLGkneqGivePIeakikkkdrkGLGa
                      ++++  G ++L++MGWk+G+G+G+  +  v P  +  +  +++GLGa
     bm03854   161    VPVEAYGLAMLRGMGWKPGEGIGRTFNQVVKPRVNSLR-PKGLGLGA 206  

                   v<-*
                   +   
     bm03854   207 N    207  

SM00739: domain 1 of 2, from 239 to 266: score 26.1, E = 0.0048
                   *->kfkkGdtVkVisGpfkGktGkvlevdre<-*
                       + +G  V V+sGp++G+ Gkv+  d++   
     bm03854   239    GLVPGGAVVVLSGPHRGLYGKVEGLDPD    266  

SM00739: domain 2 of 2, from 414 to 441: score 24.7, E = 0.012
                   *->kfkkGdtVkVisGpfkGktGkvlevdre<-*
                      +  +Gd+V+V+ Gp  G++G +l+ dr    
     bm03854   414    PKAEGDRVMVVLGPQTGRVGHLLSRDRA    441  

//