hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/Pfam.bin Sequence file: /db/iprscan/tmp/20080807/iprscan-20080807-18251648/chunk_1/iprscan-20080807-18251648.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: bm03978 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- PF01529.11.ls DHHC zinc finger domain 119.7 7.5e-33 1 PF01529.11.fs DHHC zinc finger domain 117.8 8.9e-33 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- PF01529.11.fs 1/1 156 219 .. 1 66 [] 117.8 8.9e-33 PF01529.11.ls 1/1 156 219 .. 1 66 [] 119.7 7.5e-33 Alignments of top-scoring domains: PF01529.11.fs: domain 1 of 1, from 156 to 219: score 117.8, E = 8.9e-33 *->ldndkfikdnfCskCnsyKVPpRShHCsvCnkCVlrmDHHCpWinnC ++n+ k ++C +C++++ PpR++HCs C++CV+r+DHHCpW++nC bm03978 156 INNQ-IVKLKYCYTCKIFR-PPRASHCSICDNCVERFDHHCPWVGNC 200 VGlrNyryFllFlfylill<-* VG+rNyryF+lF+++l+ll bm03978 201 VGKRNYRYFYLFILSLSLL 219 PF01529.11.ls: domain 1 of 1, from 156 to 219: score 119.7, E = 7.5e-33 *->ldndkfikdnfCskCnsyKVPpRShHCsvCnkCVlrmDHHCpWinnC ++n+ k ++C +C++++ PpR++HCs C++CV+r+DHHCpW++nC bm03978 156 INNQ-IVKLKYCYTCKIFR-PPRASHCSICDNCVERFDHHCPWVGNC 200 VGlrNyryFllFlfylill<-* VG+rNyryF+lF+++l+ll bm03978 201 VGKRNYRYFYLFILSLSLL 219 //