hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/Pfam.bin Sequence file: /db/iprscan/tmp/20080807/iprscan-20080807-18422919/chunk_1/iprscan-20080807-18422919.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: bm04001 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- PF00076.12.ls RNA recognition motif. (a.k.a. RRM, RBD, or 113.9 4.2e-31 1 PF00076.12.fs RNA recognition motif. (a.k.a. RRM, RBD, or 112.0 1.2e-30 1 PF08081.2.ls RBM1CTR (NUC064) family 100.2 5.8e-27 1 PF08081.2.fs RBM1CTR (NUC064) family 99.6 7.4e-27 2 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- PF00076.12.fs 1/1 23 94 .. 1 74 [] 112.0 1.2e-30 PF00076.12.ls 1/1 23 94 .. 1 74 [] 113.9 4.2e-31 PF08081.2.fs 1/2 186 230 .. 1 45 [] 98.2 1.8e-26 PF08081.2.ls 1/1 186 230 .. 1 45 [] 100.2 5.8e-27 Alignments of top-scoring domains: PF00076.12.fs: domain 1 of 1, from 23 to 94: score 112.0, E = 1.2e-30 *->lfVgNLppdtteedLkdlFskfGpiesikivrDttretgrskGfaFV lf+g+L+++t+e+ L++ F+k+G+i+++ +++D ret++s+GfaFV bm04001 23 LFIGGLNTETNEKALETVFGKYGRIVEVLLIKD--RETNKSRGFAFV 67 eFedeedAekAldalnGkelggrelrv<-* +Fe++ dA++A + +nGk l+g+ ++v bm04001 68 TFESPADAKDAARDMNGKSLDGKAIKV 94 PF00076.12.ls: domain 1 of 1, from 23 to 94: score 113.9, E = 4.2e-31 *->lfVgNLppdtteedLkdlFskfGpiesikivrDttretgrskGfaFV lf+g+L+++t+e+ L++ F+k+G+i+++ +++D ret++s+GfaFV bm04001 23 LFIGGLNTETNEKALETVFGKYGRIVEVLLIKD--RETNKSRGFAFV 67 eFedeedAekAldalnGkelggrelrv<-* +Fe++ dA++A + +nGk l+g+ ++v bm04001 68 TFESPADAKDAARDMNGKSLDGKAIKV 94 PF08081.2.fs: domain 1 of 2, from 186 to 230: score 98.2, E = 1.8e-26 *->sssgmGgrgplSrgRDgYGgPPRReslpSRRDdylspRDDgYstk<- sssgmGgr+plSrgRD+YGgPPRRe+lpSRRD+ylspRDDgYstk bm04001 186 SSSGMGGRAPLSRGRDSYGGPPRREPLPSRRDVYLSPRDDGYSTK 230 * bm04001 - - PF08081.2.ls: domain 1 of 1, from 186 to 230: score 100.2, E = 5.8e-27 *->sssgmGgrgplSrgRDgYGgPPRReslpSRRDdylspRDDgYstk<- sssgmGgr+plSrgRD+YGgPPRRe+lpSRRD+ylspRDDgYstk bm04001 186 SSSGMGGRAPLSRGRDSYGGPPRREPLPSRRDVYLSPRDDGYSTK 230 * bm04001 - - //