hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/smart.HMMs.bin Sequence file: /db/iprscan/tmp/20090416/iprscan-20090416-12542853/chunk_1/iprscan-20090416-12542853.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: bm04118 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- SM00088 77.7 1.4e-18 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- SM00088 1/1 327 411 .. 1 92 [] 77.7 1.4e-18 Alignments of top-scoring domains: SM00088: domain 1 of 1, from 327 to 411: score 77.7, E = 1.4e-18 *->qhverLqrkiretnllqlsepYPssislsdlakllglsvpeevEklv + e++++++r+ + ++++++ ++is+ +la++l+++ +e +E+++ bm04118 327 ACLEDFIENARLFIFETFCRIH-QCISINMLADKLNMTPEE-AERWI 371 skaIrdgeisakIDqvngivefeevdpryltsnqlaqlaerlkkl<-* +++Ir+ +++akID++ g+v++++++ ++ +q e+ k+l bm04118 372 VNLIRNARLDAKIDSKLGHVVMGNNAV-----SPYQQVIEKTKSL 411 //