hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/Pfam.bin Sequence file: /db/iprscan/tmp/20090525/iprscan-20090525-11412180/chunk_1/iprscan-20090525-11412180.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: bm04280 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- PF01412.9.ls Putative GTPase activating protein for Arf 193.7 3.9e-55 1 PF01412.9.fs Putative GTPase activating protein for Arf 191.9 6.6e-55 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- PF01412.9.fs 1/1 48 166 .. 1 137 [] 191.9 6.6e-55 PF01412.9.ls 1/1 48 166 .. 1 137 [] 193.7 3.9e-55 Alignments of top-scoring domains: PF01412.9.fs: domain 1 of 1, from 48 to 166: score 191.9, E = 6.6e-55 *->qrvlqlLrsldpgNkkCfDCgavpnPtWaSvnlGvflCieCSGiHRn q+vl+ L ++ +Nk C+DC++ + P+WaS+n+Gvf+Ci+C+GiHRn bm04280 48 QAVLANLLLEE-DNKFCADCQS-KGPRWASWNIGVFICIRCAGIHRN 92 LfGvHiSkVnvRSltLDsWtpeelrklesckgGNenansfwEsnlddfsl L GvHiS+V +S++LD+Wt+e+++ ++ ++GN +an+ +E+ l++ + bm04280 93 L-GVHISRV--KSVNLDQWTQEQIQCMQ--EMGNGKANRLYEAYLPETFR 137 kpkdsdaaavKCqddrqkyesfiaaKYeeklfvlkeeqee<-* +p+ + +e fi++KYe+k++ ++ ++ bm04280 138 RPQI-----------DPAVEGFIRDKYEKKKYMDRSLDIN 166 PF01412.9.ls: domain 1 of 1, from 48 to 166: score 193.7, E = 3.9e-55 *->qrvlqlLrsldpgNkkCfDCgavpnPtWaSvnlGvflCieCSGiHRn q+vl+ L ++ +Nk C+DC++ + P+WaS+n+Gvf+Ci+C+GiHRn bm04280 48 QAVLANLLLEE-DNKFCADCQS-KGPRWASWNIGVFICIRCAGIHRN 92 LfGvHiSkVnvRSltLDsWtpeelrklesckgGNenansfwEsnlddfsl L GvHiS+V +S++LD+Wt+e+++ ++ ++GN +an+ +E+ l++ + bm04280 93 L-GVHISRV--KSVNLDQWTQEQIQCMQ--EMGNGKANRLYEAYLPETFR 137 kpkdsdaaavKCqddrqkyesfiaaKYeeklfvlkeeqee<-* +p+ + +e fi++KYe+k++ ++ ++ bm04280 138 RPQI-----------DPAVEGFIRDKYEKKKYMDRSLDIN 166 //