hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/smart.HMMs.bin Sequence file: /db/iprscan/tmp/20090525/iprscan-20090525-11412180/chunk_1/iprscan-20090525-11412180.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: bm04280 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- SM00105 163.1 2.7e-44 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- SM00105 1/1 48 166 .. 1 139 [] 163.1 2.7e-44 Alignments of top-scoring domains: SM00105: domain 1 of 1, from 48 to 166: score 163.1, E = 2.7e-44 *->eealqlLRsikpgNkkCfDCGavpnPtWaSvnlGvflCieCSGiHRs ++ l L + +Nk+C+DC + + P+WaS+n+Gvf+Ci+C+GiHR+ bm04280 48 QAVLANLLLEE-DNKFCADCQS-KGPRWASWNIGVFICIRCAGIHRN 92 LfGvHiSkVnvRSltLDtWteeeLrllesckgGNenansfwesnlddfsl L GvHiS+V +S++LD+Wt+e+++ ++ + GN +an+ +e+ l++ bm04280 93 L-GVHISRV--KSVNLDQWTQEQIQCMQ--EMGNGKANRLYEAYLPETFR 137 kpkdsdaaasvKCeddrqkyesfiaaKYeeklfrvdkesaee<-* +p++ ++ +e fi++KYe+k+ d+ + bm04280 138 RPQI------------DPAVEGFIRDKYEKKKY-MDRSLDIN 166 //