hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/Pfam.bin Sequence file: /db/iprscan/tmp/20080807/iprscan-20080807-19502173/chunk_1/iprscan-20080807-19502173.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: bm04489 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- PF00226.21.fs DnaJ domain 135.5 1.2e-39 1 PF00226.21.ls DnaJ domain 137.3 3.8e-38 1 PF01556.9.fs DnaJ C terminal region 63.2 3.4e-17 1 PF01556.9.ls DnaJ C terminal region 58.8 1.6e-14 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- PF00226.21.fs 1/1 14 75 .. 1 76 [] 135.5 1.2e-39 PF00226.21.ls 1/1 14 75 .. 1 76 [] 137.3 3.8e-38 PF01556.9.ls 1/1 226 348 .. 1 123 [] 58.8 1.6e-14 PF01556.9.fs 1/1 252 348 .. 28 123 .] 63.2 3.4e-17 Alignments of top-scoring domains: PF00226.21.fs: domain 1 of 1, from 14 to 75: score 135.5, E = 1.2e-39 *->dyYeiLGvprdAsdeeIKKAYRkLAlkyHPDKNpgdpeerktnerae dyY+ LG+ r+AsdeeIK+AYR++Al+yHPDKN++++ bm04489 14 DYYQTLGLARGASDEEIKRAYRRQALRYHPDKNKEPG---------- 50 skeeAeekFkeineAYevLSDpekRaiYD<-* AeekFkei+eAY+vLSDp kR+i+D bm04489 51 ----AEEKFKEIAEAYDVLSDPRKREIFD 75 PF00226.21.ls: domain 1 of 1, from 14 to 75: score 137.3, E = 3.8e-38 *->dyYeiLGvprdAsdeeIKKAYRkLAlkyHPDKNpgdpeerktnerae dyY+ LG+ r+AsdeeIK+AYR++Al+yHPDKN++++ bm04489 14 DYYQTLGLARGASDEEIKRAYRRQALRYHPDKNKEPG---------- 50 skeeAeekFkeineAYevLSDpekRaiYD<-* AeekFkei+eAY+vLSDp kR+i+D bm04489 51 ----AEEKFKEIAEAYDVLSDPRKREIFD 75 PF01556.9.ls: domain 1 of 1, from 226 to 348: score 58.8, E = 1.6e-14 *->qrlRlaGeGeaGenGGppGDLYVvirVkeHkiFeRdGdDLycevpis +++ +++eG++ n p D v++ k+H+iF+RdG D+++ + is bm04489 226 TKITFPKEGDQTSNN-IPADIVFVLKDKPHNIFKRDGSDVIYPARIS 271 ftqAaLGgeveVPTLdG.kvkLkIPaGTQsGkvfrLkGKGvpklnrgsgr + +A +G++v VPTLdG+ + + +G + + G+G p + r bm04489 272 LREALCGCTVNVPTLDGrTIPVVFKDVIRPGMRRKVPGEGLPLPKTPEKR 321 GDLyVhVkVetPkkLseeQkeLLeela<-* GDL+++++V P+++ + + +Le+ bm04489 322 GDLIIEFEVIFPERIPQTSRTVLEQVL 348 PF01556.9.fs: domain 1 of 1, from 252 to 348: score 63.2, E = 3.4e-17 *->keHkiFeRdGdDLycevpisftqAaLGgeveVPTLdG.kvkLkIPaG k+H+iF+RdG D+++ + is+ +A +G++v VPTLdG+ + + bm04489 252 KPHNIFKRDGSDVIYPARISLREALCGCTVNVPTLDGrTIPVVFKDV 298 TQsGkvfrLkGKGvpklnrgsgrGDLyVhVkVetPkkLseeQkeLLeela +G + + G+G p + rGDL+++++V P+++ + + +Le+ bm04489 299 IRPGMRRKVPGEGLPLPKTPEKRGDLIIEFEVIFPERIPQTSRTVLEQVL 348 <-* bm04489 - - //