hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/smart.HMMs.bin Sequence file: /db/iprscan/tmp/20090618/iprscan-20090618-00315707/chunk_1/iprscan-20090618-00315707.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: bm04741 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- SM00088 96.8 2.6e-24 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- SM00088 1/1 784 872 .. 1 92 [] 96.8 2.6e-24 Alignments of top-scoring domains: SM00088: domain 1 of 1, from 784 to 872: score 96.8, E = 2.6e-24 *->qhverLqrkiretnllqlsepYPssislsdlakllglsvpeevEklv ++v+++q++ ++t+l+++s++Y +sis+++l+++++l+ p+ v++++ bm04741 784 MLVRKIQEESLRTYLFTYSSVY-DSISMETLSDMFELDLPT-VHSII 828 skaIrdgeisakIDqvngivefeevdpryltsnqlaqlaerlkkl<-* sk+I+++e++a++Dq++++v++++++p + +n qlae+l +l bm04741 829 SKMIINEELMASLDQPTQTVVMHRTEPTAQ-QNLALQLAEKLGSL 872 //