hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/Pfam.bin Sequence file: /db/iprscan/tmp/20090416/iprscan-20090416-11454009/chunk_1/iprscan-20090416-11454009.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: bm04834 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- PF03909.7.fs BSD domain 67.9 5.6e-19 1 PF03909.7.ls BSD domain 69.9 7.6e-18 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- PF03909.7.fs 1/1 181 246 .. 1 68 [] 67.9 5.6e-19 PF03909.7.ls 1/1 181 246 .. 1 68 [] 69.9 7.6e-18 Alignments of top-scoring domains: PF03909.7.fs: domain 1 of 1, from 181 to 246: score 67.9, E = 5.6e-19 *->dlkpsdswdnefdldekteehiqalLkedpaLrklynelVPkkvste +++p+++ ++fd+d+ + ++ +L+ed+ L+k+++ lVPk v+ e bm04834 181 LRDPPAGVQFNFDFDQMYPV-ALVMLQEDELLSKMRFALVPKLVK-E 225 eeFWarYFyllrkillkeeqr<-* e FW++YFy++ +i+++ + bm04834 226 EVFWRNYFYRVSLIKQSAQLT 246 PF03909.7.ls: domain 1 of 1, from 181 to 246: score 69.9, E = 7.6e-18 *->dlkpsdswdnefdldekteehiqalLkedpaLrklynelVPkkvste +++p+++ ++fd+d+ + ++ +L+ed+ L+k+++ lVPk v+ e bm04834 181 LRDPPAGVQFNFDFDQMYPV-ALVMLQEDELLSKMRFALVPKLVK-E 225 eeFWarYFyllrkillkeeqr<-* e FW++YFy++ +i+++ + bm04834 226 EVFWRNYFYRVSLIKQSAQLT 246 //