hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/Pfam.bin Sequence file: /db/iprscan/tmp/20080807/iprscan-20080807-21521154/chunk_1/iprscan-20080807-21521154.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: bm04873 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- PF02173.8.fs pKID domain 84.3 4.1e-25 1 PF02173.8.ls pKID domain 86.3 8.8e-23 1 PF00170.11.fs bZIP transcription factor 80.9 2.5e-22 1 PF00170.11.ls bZIP transcription factor 82.8 1e-21 1 PF07716.5.ls Basic region leucine zipper 26.6 8.4e-05 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- PF02173.8.ls 1/1 113 153 .. 1 42 [] 86.3 8.8e-23 PF02173.8.fs 1/1 113 153 .. 1 42 [] 84.3 4.1e-25 PF00170.11.fs 1/1 281 341 .] 1 65 [] 80.9 2.5e-22 PF07716.5.ls 1/1 281 335 .. 1 57 [] 26.6 8.4e-05 PF00170.11.ls 1/1 281 341 .] 1 65 [] 82.8 1e-21 Alignments of top-scoring domains: PF02173.8.ls: domain 1 of 1, from 113 to 153: score 86.3, E = 8.8e-23 *->essdsdessPqkRREILaRRPSYRKILnDLsgddpvdpkgee<-* es+ds+++s qkRREIL+RRPSYRKILnDLs+d+p+ p++ee bm04873 113 ESVDSVTDS-QKRREILSRRPSYRKILNDLSSDAPGVPRIEE 153 PF02173.8.fs: domain 1 of 1, from 113 to 153: score 84.3, E = 4.1e-25 *->essdsdessPqkRREILaRRPSYRKILnDLsgddpvdpkgee<-* es+ds+++s qkRREIL+RRPSYRKILnDLs+d+p+ p++ee bm04873 113 ESVDSVTDS-QKRREILSRRPSYRKILNDLSSDAPGVPRIEE 153 PF00170.11.fs: domain 1 of 1, from 281 to 341: score 80.9, E = 2.5e-22 *->ekelKrerRkqkNReAArrsRlRKqaeieeLeekveeLeaeNkaLrk e+++Kre R++kNReAAr++R++K++++++Le++v++Le++Nk+L++ bm04873 281 EAARKREVRLMKNREAARECRRKKKEYVKCLENRVAVLENQNKTLIE 327 elerLkkevakLksenee<-* el+ Lk++++ ++++ bm04873 328 ELKALKDLYC----HKSD 341 PF07716.5.ls: domain 1 of 1, from 281 to 335: score 26.6, E = 8.4e-05 *->kddeyrdrRrlrNneAAkrsReKkKqreeeleervkeLeeeNaqLLk + + +r+ R ++N+eAA+ +R KkK++ + le+rv Le +N +L bm04873 281 EAARKREVRLMKNREAARECRRKKKEYVKCLENRVAVLENQNKTL-- 325 rqkveqLekE<-* +++++L++ bm04873 326 IEELKALKDL 335 PF00170.11.ls: domain 1 of 1, from 281 to 341: score 82.8, E = 1e-21 *->ekelKrerRkqkNReAArrsRlRKqaeieeLeekveeLeaeNkaLrk e+++Kre R++kNReAAr++R++K++++++Le++v++Le++Nk+L++ bm04873 281 EAARKREVRLMKNREAARECRRKKKEYVKCLENRVAVLENQNKTLIE 327 elerLkkevakLksenee<-* el+ Lk++++ ++++ bm04873 328 ELKALKDLYC----HKSD 341 //