hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/smart.HMMs.bin Sequence file: /db/iprscan/tmp/20080807/iprscan-20080807-22110848/chunk_1/iprscan-20080807-22110848.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: bm04925 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- SM00088 73.3 3.1e-17 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- SM00088 1/1 108 198 .. 1 92 [] 73.3 3.1e-17 Alignments of top-scoring domains: SM00088: domain 1 of 1, from 108 to 198: score 73.3, E = 3.1e-17 *->qhverLqrkiretnllqlsepYPssislsdlakllglsvpeevEklv +++e++ +k+r++ +l+ ++i++ l ++l l++ +++E+lv bm04925 108 PLTEAQKNKLRHLSVVTLAAKV-KCIPYAVLLEALALRNVRQLEDLV 153 skaIrdgeisakIDqvngivefeevdpryltsnqlaqlaerlkkl<-* ++a++++ +++++Dq+n+++e++ + +r+++++ l ++a +l+++ bm04925 154 IEAVYADVLRGSLDQRNQRLEVDYSIGRDIQRQDLSAIARTLQEW 198 //