hmmpfam - search one or more sequences against HMM database
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file:                 /db/iprscan/data/smart.HMMs.bin
Sequence file:            /db/iprscan/tmp/20080807/iprscan-20080807-22164423/chunk_1/iprscan-20080807-22164423.nocrc
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query sequence: bm04933
Accession:      [none]
Description:    [none]

Scores for sequence family classification (score includes all domains):
Model    Description                                    Score    E-value  N 
-------- -----------                                    -----    ------- ---
SM00382                                                  35.0    9.8e-06   1

Parsed for domains:
Model    Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
-------- ------- ----- -----    ----- -----      -----  -------
SM00382    1/1      80   278 ..     1    92 []    35.0  9.8e-06

Alignments of top-scoring domains:
SM00382: domain 1 of 1, from 80 to 278: score 35.0, E = 9.8e-06
                   *->pgevvllvGppGsGKTTlaralarllgp....gviyidge.......
                      +++  ++ Gp+G GK+ l+  la   +p++ +g ++i+g  +  + +
     bm04933    80    KPGLNAILGPTGGGKSSLLDVLAARKDPsglsGDVLINGAprpanfk 126  

                   ..................................................
                    +++   +++   +    +++ + +   +      +++++++ ++  ++ 
     bm04933   127 cnsgyvvqddvvmgtltvrenlqfsaalrlattmtnheknerinrviqel 176  

                   ....................ggqrir.lalalark.dvlllDEitslld.
                   + ++  +++ + +  ++ ++g+++  ++ ++l+  +++l+lDE+t+ ld+
     bm04933   177 gldkvadskvgtqfirgvsgGERKRTsIGMELITDpSILFLDEPTTGLDs 226  

                   .................vtviattn......dldpallrrrfdrrivllr
                   +  +  ++++++ +++++t+i+  ++++ + +++ + l + ++ r+++  
     bm04933   227 stanavllllkrmskqgRTIIFSIHqprysiFKLFDSLTLLASGRLMFHG 276  

                   il<-*
                   +    
     bm04933   277 PA    278  

//