hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/smart.HMMs.bin Sequence file: /db/iprscan/tmp/20080807/iprscan-20080807-22595203/chunk_1/iprscan-20080807-22595203.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: bm05157 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- SM00559 214.3 1.1e-59 1 SM00513 30.4 0.00024 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- SM00559 1/1 312 458 .. 1 155 [] 214.3 1.1e-59 SM00513 1/1 577 611 .. 1 35 [] 30.4 0.00024 Alignments of top-scoring domains: SM00559: domain 1 of 1, from 312 to 458: score 214.3, E = 1.1e-59 *->gkevkpedivkgYeyGkgryvvlsdqdeleqlkyksedpgleilGFv g+ ++p+d+++++ yG +r+++l++ +e+e+lk++++ pgl+++GF+ bm05157 312 GGLLLPSDTKRSQIYG-SRQIILEK-EETEELKRFDD-PGLMLMGFK 355 plselppyyflkpsyflvPddksvegstkafsaLleaLletnkiAIarfv pl l+++++l+ps f++P+++ v+gs+++fsaLl ++le++++A++r++ bm05157 356 PLVLLKKHHYLRPSLFVYPEESLVIGSSTLFSALLIKCLEKEVAALCRYT 405 lrtksnrprLvaLrPyeeekddqdsqkkppltveglvlvqLPFaDdvRkl +r++++ p++vaL+P+eee ddq++q++pp g+ lv LPFaDd Rk bm05157 406 PRRNIP-PYFVALVPQEEELDDQKIQVTPP----GFQLVFLPFADDKRKM 450 dflelnpt<-* +f e+ ++ bm05157 451 PFTEKIMA 458 SM00513: domain 1 of 1, from 577 to 611: score 30.4, E = 0.00024 *->lskLkVseLkdeLkkrGLstsGrKaeLvkRLleal<-* l k++V +Lk+ ++++GL + +K+eL++ L+++ bm05157 577 LGKFTVPMLKEACRAYGLKSGLKKQELLEALTKHF 611 //