hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/Pfam.bin Sequence file: /db/iprscan/tmp/20080807/iprscan-20080807-23430687/chunk_1/iprscan-20080807-23430687.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: bm05381 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- PF01569.12.fs PAP2 superfamily 56.5 3.3e-15 1 PF01569.12.ls PAP2 superfamily 58.2 2.6e-14 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- PF01569.12.fs 1/1 185 304 .. 1 177 [] 56.5 3.3e-15 PF01569.12.ls 1/1 185 304 .. 1 177 [] 58.2 2.6e-14 Alignments of top-scoring domains: PF01569.12.fs: domain 1 of 1, from 185 to 304: score 56.5, E = 3.3e-15 *->aalalllalvaslllnglaylKllfgrpRApPhflavcqpdwgdstc ++ lllal++ ++++ + l+ R+ P bm05381 185 VLMNLLLALLLDIMTVAG--VQKLI--KRRGP--------------- 212 sdlwyeellgyefycmagspgldridlfgsvlltsafalvseagpSFPSG + +s + + ++FP G bm05381 213 -----------------------------YEMSPSLLDYLTMDIYAFPAG 233 HaafaaafalflalylprrlsklgrllrlllgllllllallvglSRvylg Ha+ aa+++ f++ +l + +l++ll+l+al+vglSRv+ g bm05381 234 HASRAAMVSKFFLSHLVL---------AVPLRVLLVLWALCVGLSRVMIG 274 vHypsDVlaGallGaliaalvllfvrrlld<-* H+ +DVl G+++G+l + lv l++ + + bm05381 275 RHHVTDVLSGFVIGYLQFRLVELVWMPSST 304 PF01569.12.ls: domain 1 of 1, from 185 to 304: score 58.2, E = 2.6e-14 *->aalalllalvaslllnglaylKllfgrpRApPhflavcqpdwgdstc ++ lllal++ ++++ + l+ R+ P bm05381 185 VLMNLLLALLLDIMTVAG--VQKLI--KRRGP--------------- 212 sdlwyeellgyefycmagspgldridlfgsvlltsafalvseagpSFPSG + +s + + ++FP G bm05381 213 -----------------------------YEMSPSLLDYLTMDIYAFPAG 233 HaafaaafalflalylprrlsklgrllrlllgllllllallvglSRvylg Ha+ aa+++ f++ +l + +l++ll+l+al+vglSRv+ g bm05381 234 HASRAAMVSKFFLSHLVL---------AVPLRVLLVLWALCVGLSRVMIG 274 vHypsDVlaGallGaliaalvllfvrrlld<-* H+ +DVl G+++G+l + lv l++ + + bm05381 275 RHHVTDVLSGFVIGYLQFRLVELVWMPSST 304 //