hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/Pfam.bin Sequence file: /db/iprscan/tmp/20080808/iprscan-20080808-00520874/chunk_1/iprscan-20080808-00520874.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: bm05593 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- PF00804.15.ls Syntaxin 132.6 1e-36 1 PF00804.15.fs Syntaxin 130.6 4e-36 1 PF05739.9.ls SNARE domain 105.3 1.6e-28 1 PF05739.9.fs SNARE domain 103.4 6.1e-28 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- PF00804.15.fs 1/1 30 132 .. 1 110 [] 130.6 4e-36 PF00804.15.ls 1/1 30 132 .. 1 110 [] 132.6 1e-36 PF05739.9.fs 1/1 198 260 .. 1 63 [] 103.4 6.1e-28 PF05739.9.ls 1/1 198 260 .. 1 63 [] 105.3 1.6e-28 Alignments of top-scoring domains: PF00804.15.fs: domain 1 of 1, from 30 to 132: score 130.6, E = 4e-36 *->slpeFfeekveeIrnniekisqkleeLaklhkkilsppdsdveikel +++eFfe+ veeIr+ i+ki++++ee++++h++il+ p++d +++ bm05593 30 FMDEFFEQ-VEEIRGFIDKIAENVEEVKRKHSAILASPNPD---EKT 72 rrkleqliteinqlakklkrklkaleeanlseersqlsssdtrirktqts +++le+l+++i+++a+k++ klk++e+++++ee++++ss+d+rirktq+s bm05593 73 KEELEELMSDIKKTANKVRSKLKSIEQSIEQEEGLNRSSADLRIRKTQHS 122 llsGlrkkfkevm<-* +ls rk f+evm bm05593 123 TLS--RK-FVEVM 132 PF00804.15.ls: domain 1 of 1, from 30 to 132: score 132.6, E = 1e-36 *->slpeFfeekveeIrnniekisqkleeLaklhkkilsppdsdveikel +++eFfe+ veeIr+ i+ki++++ee++++h++il+ p++d +++ bm05593 30 FMDEFFEQ-VEEIRGFIDKIAENVEEVKRKHSAILASPNPD---EKT 72 rrkleqliteinqlakklkrklkaleeanlseersqlsssdtrirktqts +++le+l+++i+++a+k++ klk++e+++++ee++++ss+d+rirktq+s bm05593 73 KEELEELMSDIKKTANKVRSKLKSIEQSIEQEEGLNRSSADLRIRKTQHS 122 llsGlrkkfkevm<-* +ls rk f+evm bm05593 123 TLS--RK-FVEVM 132 PF05739.9.fs: domain 1 of 1, from 198 to 260: score 103.4, E = 6.1e-28 *->eRdeeleelessigeLkqlfldlgteVeeQgellDrIddnventqsr R+ e+ +le si+eL+++f+d++++Ve+Qge++DrI++nve+++++ bm05593 198 TRHSEIIKLENSIRELHDMFMDMAMLVESQGEMIDRIEYNVEHAVDY 244 verankrLkkaaryqk<-* vera + kka++yq+ bm05593 245 VERAVSDTKKAVKYQS 260 PF05739.9.ls: domain 1 of 1, from 198 to 260: score 105.3, E = 1.6e-28 *->eRdeeleelessigeLkqlfldlgteVeeQgellDrIddnventqsr R+ e+ +le si+eL+++f+d++++Ve+Qge++DrI++nve+++++ bm05593 198 TRHSEIIKLENSIRELHDMFMDMAMLVESQGEMIDRIEYNVEHAVDY 244 verankrLkkaaryqk<-* vera + kka++yq+ bm05593 245 VERAVSDTKKAVKYQS 260 //