hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/smart.HMMs.bin Sequence file: /db/iprscan/tmp/20080808/iprscan-20080808-00520874/chunk_1/iprscan-20080808-00520874.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: bm05593 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- SM00503 155.3 6.3e-42 1 SM00397 95.8 5e-24 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- SM00503 1/1 26 147 .. 1 127 [] 155.3 6.3e-42 SM00397 1/1 188 255 .. 1 68 [] 95.8 5e-24 Alignments of top-scoring domains: SM00503: domain 1 of 1, from 26 to 147: score 155.3, E = 6.3e-42 *->ardsnldeFfeeveeIraeIqkieqnveelqklheelltspdaeadk +rd ++deFfe+veeIr+ I+ki +nvee+++ h+++l+sp+ +d+ bm05593 26 DRDRFMDEFFEQVEEIRGFIDKIAENVEEVKRKHSAILASPN--PDE 70 elrekLerdikdikrlakeikskLkalekaneenrasngCGpgSsvdrtR +++e+Le+++ dik+ a++++skLk++e+++e+ + +n ++S++ r+R bm05593 71 KTKEELEELMSDIKKTANKVRSKLKSIEQSIEQEEGLN---RSSADLRIR 117 kaqtekLrkkFkevmneFqrlQrkyreryk<-* k+q++ L++kF+evm+e++ +Q++yrer+k bm05593 118 KTQHSTLSRKFVEVMSEYNATQSDYRERCK 147 SM00397: domain 1 of 1, from 188 to 255: score 95.8, E = 5e-24 *->llqqndameqerdeeleqlersiqelkqifldlgteveeQgeqldrI + +q++++++ r+ e+ +le+si+el+++f+d++++ve+Qge++drI bm05593 188 ISKQALSEIETRHSEIIKLENSIRELHDMFMDMAMLVESQGEMIDRI 234 ednvdntdvnlkkankqLkka<-* e+nv+++++++++a++ kka bm05593 235 EYNVEHAVDYVERAVSDTKKA 255 //