hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/Pfam.bin Sequence file: /db/iprscan/tmp/20080808/iprscan-20080808-01041346/chunk_1/iprscan-20080808-01041346.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: bm05643 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- PF00096.16.ls Zinc finger, C2H2 type 234.6 2e-67 7 PF00096.16.fs Zinc finger, C2H2 type 220.8 2.7e-63 7 PF01352.17.fs KRAB box 98.7 1.9e-27 1 PF01352.17.ls KRAB box 100.7 3.9e-27 1 PF01096.9.fs Transcription factor S-II (TFIIS) 28.7 3.6e-08 7 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- PF01352.17.fs 1/1 52 92 .. 1 41 [] 98.7 1.9e-27 PF01352.17.ls 1/1 52 92 .. 1 41 [] 100.7 3.9e-27 PF00096.16.ls 1/7 284 306 .. 1 24 [] 35.2 2.2e-07 PF00096.16.fs 1/7 284 306 .. 1 24 [] 33.2 5.1e-07 PF00096.16.ls 2/7 312 334 .. 1 24 [] 36.3 9.6e-08 PF00096.16.fs 2/7 312 334 .. 1 24 [] 34.4 2.6e-07 PF00096.16.ls 3/7 340 362 .. 1 24 [] 30.1 7.1e-06 PF00096.16.fs 3/7 340 362 .. 1 24 [] 28.2 9.1e-06 PF00096.16.ls 4/7 368 390 .. 1 24 [] 35.2 2.2e-07 PF00096.16.fs 4/7 368 390 .. 1 24 [] 33.2 5.1e-07 PF00096.16.ls 5/7 396 418 .. 1 24 [] 29.6 1e-05 PF00096.16.fs 5/7 396 418 .. 1 24 [] 27.6 1.3e-05 PF00096.16.ls 6/7 424 446 .. 1 24 [] 34.2 4.1e-07 PF00096.16.fs 6/7 424 446 .. 1 24 [] 32.3 8.6e-07 PF00096.16.ls 7/7 494 516 .. 1 24 [] 34.0 4.7e-07 PF00096.16.fs 7/7 494 516 .. 1 24 [] 32.1 9.6e-07 Alignments of top-scoring domains: PF01352.17.fs: domain 1 of 1, from 52 to 92: score 98.7, E = 1.9e-27 *->VtFeDVaVdFtqEEWelLdpaQrnLYrdVMlENysnLvSlg<-* VtF+DVaVdFtqEEW++Ldp+Qr LYrdVMlE++++L+S+g bm05643 52 VTFRDVAVDFTQEEWGQLDPTQRILYRDVMLETFGHLLSIG 92 PF01352.17.ls: domain 1 of 1, from 52 to 92: score 100.7, E = 3.9e-27 *->VtFeDVaVdFtqEEWelLdpaQrnLYrdVMlENysnLvSlg<-* VtF+DVaVdFtqEEW++Ldp+Qr LYrdVMlE++++L+S+g bm05643 52 VTFRDVAVDFTQEEWGQLDPTQRILYRDVMLETFGHLLSIG 92 PF00096.16.ls: domain 1 of 7, from 284 to 306: score 35.2, E = 2.2e-07 *->ykCpfdCgksFsrksnLkrHlrtH<-* ykC+ dCgksF+++++L+ H+r+H bm05643 284 YKCT-DCGKSFNHNAHLTVHKRIH 306 PF00096.16.fs: domain 1 of 7, from 284 to 306: score 33.2, E = 5.1e-07 *->ykCpfdCgksFsrksnLkrHlrtH<-* ykC+ dCgksF+++++L+ H+r+H bm05643 284 YKCT-DCGKSFNHNAHLTVHKRIH 306 PF00096.16.ls: domain 2 of 7, from 312 to 334: score 36.3, E = 9.6e-08 *->ykCpfdCgksFsrksnLkrHlrtH<-* y+C+ +Cgk+Fs++s+L +H r+H bm05643 312 YMCK-ECGKAFSQNSSLVQHERIH 334 PF00096.16.fs: domain 2 of 7, from 312 to 334: score 34.4, E = 2.6e-07 *->ykCpfdCgksFsrksnLkrHlrtH<-* y+C+ +Cgk+Fs++s+L +H r+H bm05643 312 YMCK-ECGKAFSQNSSLVQHERIH 334 PF00096.16.ls: domain 3 of 7, from 340 to 362: score 30.1, E = 7.1e-06 *->ykCpfdCgksFsrksnLkrHlrtH<-* ykC +CgksF+++ +L+ H+r+H bm05643 340 YKCA-ECGKSFCHSTHLTVHRRIH 362 PF00096.16.fs: domain 3 of 7, from 340 to 362: score 28.2, E = 9.1e-06 *->ykCpfdCgksFsrksnLkrHlrtH<-* ykC +CgksF+++ +L+ H+r+H bm05643 340 YKCA-ECGKSFCHSTHLTVHRRIH 362 PF00096.16.ls: domain 4 of 7, from 368 to 390: score 35.2, E = 2.2e-07 *->ykCpfdCgksFsrksnLkrHlrtH<-* y+C+ dCg++F+++s+L rH+rtH bm05643 368 YECQ-DCGRAFNQNSSLGRHKRTH 390 PF00096.16.fs: domain 4 of 7, from 368 to 390: score 33.2, E = 5.1e-07 *->ykCpfdCgksFsrksnLkrHlrtH<-* y+C+ dCg++F+++s+L rH+rtH bm05643 368 YECQ-DCGRAFNQNSSLGRHKRTH 390 PF00096.16.ls: domain 5 of 7, from 396 to 418: score 29.6, E = 1e-05 *->ykCpfdCgksFsrksnLkrHlrtH<-* y+C+ +CgksFsr L HlrtH bm05643 396 YTCS-VCGKSFSRTTCLFLHLRTH 418 PF00096.16.fs: domain 5 of 7, from 396 to 418: score 27.6, E = 1.3e-05 *->ykCpfdCgksFsrksnLkrHlrtH<-* y+C+ +CgksFsr L HlrtH bm05643 396 YTCS-VCGKSFSRTTCLFLHLRTH 418 PF00096.16.ls: domain 6 of 7, from 424 to 446: score 34.2, E = 4.1e-07 *->ykCpfdCgksFsrksnLkrHlrtH<-* y+C+ +Cgk F+++s+L +H+r+H bm05643 424 YECN-HCGKGFRHSSSLAQHQRKH 446 PF00096.16.fs: domain 6 of 7, from 424 to 446: score 32.3, E = 8.6e-07 *->ykCpfdCgksFsrksnLkrHlrtH<-* y+C+ +Cgk F+++s+L +H+r+H bm05643 424 YECN-HCGKGFRHSSSLAQHQRKH 446 PF00096.16.ls: domain 7 of 7, from 494 to 516: score 34.0, E = 4.7e-07 *->ykCpfdCgksFsrksnLkrHlrtH<-* +kC+ +Cgk+F ++s+L rH+ tH bm05643 494 FKCN-QCGKCFIQSSHLIRHQITH 516 PF00096.16.fs: domain 7 of 7, from 494 to 516: score 32.1, E = 9.6e-07 *->ykCpfdCgksFsrksnLkrHlrtH<-* +kC+ +Cgk+F ++s+L rH+ tH bm05643 494 FKCN-QCGKCFIQSSHLIRHQITH 516 //