hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/smart.HMMs.bin Sequence file: /db/iprscan/tmp/20080808/iprscan-20080808-01235923/chunk_1/iprscan-20080808-01235923.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: bm05685 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- SM00226 257.7 9.1e-73 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- SM00226 1/1 14 163 .. 1 155 [] 257.7 9.1e-73 Alignments of top-scoring domains: SM00226: domain 1 of 1, from 14 to 163: score 257.7, E = 9.1e-73 *->kkVLFVCtGNiCRSpmAEalfrhllpkrglsdkwevdSAGtepWhVg k+VLFVC+GNiCRSp+AEa+fr+l++++++s++w+vdSA+t+++++g bm05685 14 KSVLFVCLGNICRSPIAEAVFRKLVTDQNISENWRVDSAATSGYEIG 60 hpaDprAvevlkehGidisghrpkpARQlteedlkdfDlIltmdesaire +p+D r ++++k+hGi++s+ ARQ+t+ed++ fD+Il+mdes++r+ bm05685 61 NPPDYRGQSCMKRHGIPMSHV----ARQITKEDFATFDYILCMDESNLRD 106 icplaPg.eesrakvelwghwdeq...dipDPyyaGtEagsidaFeevrd +++ + ++ak+el+g++d+q++ +i+DPyy g + +Fe+v++ bm05685 107 LNRKSNRvKTCKAKIELLGSYDPQkqlIIEDPYY-----GNDSDFETVYQ 151 eIerrvkkllke<-* ++ r+++++l++ bm05685 152 QCVRCCRAFLEK 163 //